KEGG   Drosophila willistoni: Dwil_GK18192Help
Entry
Dwil_GK18192      CDS       T01067                                 

Definition
GK18192 gene product from transcript GK18192-RA
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dwi  Drosophila willistoni
Pathway
FoxO signaling pathway
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dwil_GK18192
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dwil_GK18192
Protein kinases [BR:dwi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dwil_GK18192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 364 aa AA seqDB search
MPKFYKLDINRTEWEIPETYQNLQAVGQGAYGQVCKALVQNTNTKVAIKKLARPFQSAVH
AKRTYRELRLLKHMDHENVIGLLDVFHPGQPADSLEQFQQVYMVTHLMDADLNNIIRTQK
LSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPAESEMTG
YVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEVLGT
PAEEFMNRISSDSARSYIRSLPVMPRRHFRDVFRGANPLAIDLLEKMLELDADRRITAEQ
ALAHPYMEKYHDPTDEQTSALYDQSFEENELPVEKWKDLVFTEVQSFKPPQAFAELLQQD
AQQK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaattctacaagctggatattaatcgcactgaatgggagataccggaaacctac
cagaacctccaggccgtcgggcaaggcgcctatggtcaagtatgcaaagctctagtgcaa
aacaccaacacaaaagtggcgattaaaaaattggccaggccgtttcaatctgctgttcat
gctaaacgaacatatcgtgaactgcggctgcttaagcatatggatcatgagaacgtcatc
ggcctactggatgtatttcatcctggccaaccagcagattcgctggaacaatttcaacaa
gtgtacatggtgacgcatctcatggacgcggatcttaataacattataagaacgcaaaag
ctatcggatgatcatgtccagtttttggtctaccagatactgcgtggccttaaatatatt
catagcgctggtgtgatccatcgggatctcaagccgtcaaatatcgctgtaaacgaggat
tgtgagctccgcattttggatttcggtctggcacgaccagccgagagtgagatgacgggc
tatgtggccacacgttggtatcgggcacccgaaattatgctcaactggatgcactacaac
cagactgtagacatatggtctgttggctgcattatggcagaattgttgacaggaaggact
ctgtttccaggcaccgatcacattcaccaattgaaccttattatggaggttttgggtacc
ccggccgaagagtttatgaaccgcatttcatcggatagcgcacgttcatatattcgctca
ttgcccgttatgccgcgtcgtcatttccgtgatgtcttccgtggtgccaatcccttggca
attgatttgcttgaaaaaatgctcgagctggatgcagatcgtcgcattacagcggaacag
gctctagcccatccttatatggagaaatatcacgatccaaccgatgagcaaacatcggcc
ctctacgatcagagtttcgaggagaacgagctgccggtggagaagtggaaggatctggta
tttaccgaagttcaaagctttaagccgccacaagcctttgccgagctactgcagcaagat
gcgcagcaaaaatag

DBGET integrated database retrieval system