KEGG   Drosophila willistoni: Dwil_GK18199Help
Entry
Dwil_GK18199      CDS       T01067                                 

Definition
GK18199 gene product from transcript GK18199-RA
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
dwi  Drosophila willistoni
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dwil_GK18199
Enzymes [BR:dwi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Dwil_GK18199
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 297 aa AA seqDB search
MAQTAASMAATSVVVLDRGNNTTCTINLHGATVVSWRVNNQEQLFVSKLASFDGKKAIRG
GIPFVFPQFGAWSFGPQHGFARITRWHLERAPERLHNGDVEAIFSLMDNEFTRSIWNYQF
RITYRLILREKELHFHIGVYNPSKELSFTFNMLLHTYLKVPDVRRCQITGLQGCHFIDKT
RENALYQEGREVVTVNEWTDRIYQHTPQEHVITNVVSGRKMRLHKYNFPDTVIWNPWIDR
SREMSDFGDDEFPNMLCVEAGNVSSPVILLPGTAFEASQILQIIIEGNVSRKTKRNR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaacagcggcctcaatggcggccactagtgtcgttgtattggatcggggaaat
aacacaacttgcaccattaacttgcatggcgccacagttgtctcgtggagggttaacaat
caggagcagttatttgtcagtaaactggcctcatttgatggcaagaaggcgatacgaggt
ggcataccctttgtgtttcctcaatttggtgcctggtcctttggtccacaacatggattt
gcccgtatcacacgttggcatttggaaagggcgccagagcgtctacacaatggtgatgtg
gaggccatattctcgctaatggataatgaatttacccgctccatttggaattatcaattc
cgcattacctatcgtcttatattacgcgaaaaggaactacattttcacattggcgtctac
aatcctagcaaggaattaagttttaccttcaatatgctgctccatacctatttgaaggtg
cccgatgtacgaagatgtcagataactggcctgcaaggctgccatttcattgataagacc
cgcgagaatgccttatatcaggagggcagggaagttgtcacagtaaatgagtggaccgat
agaatctatcagcatacaccgcaagagcatgtgataaccaatgtggtatccggacgcaag
atgagactgcataaatacaattttccagacacagttatctggaatccctggattgatcgt
tcgcgcgaaatgagcgattttggtgatgatgagtttcccaatatgttgtgcgtagaggcg
ggcaatgttagttctcccgtcatcctcttaccgggcacagcttttgaggccagtcagatt
ctacagatcatcatcgagggtaatgtgagtcgtaagactaaacggaatcgctag

DBGET integrated database retrieval system