KEGG   Drosophila willistoni: Dwil_GK18205Help
Entry
Dwil_GK18205      CDS       T01067                                 

Definition
GK18205 gene product from transcript GK18205-RA
Orthology
K08738  
cytochrome c
Organism
dwi  Drosophila willistoni
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:dwi00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 105 aa AA seqDB search
MGAGDADNGKKIFVQKCAQCHTIEAGGKHKVGPNLSGVVGRKCGTAPGYKYTDANISRGV
TWTESNLDEYLKDPKKYIPGTKMVFVGLKKAEDRADLIAYLKRGK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggggccggcgatgcagataatggcaaaaagattttcgttcagaaatgcgcccaatgt
cataccattgaagcgggtggcaagcataaagttggacccaatctaagcggagttgtggga
cgtaaatgcggcactgctccgggctacaaatatactgatgcaaatataagtaggggcgtt
acatggacagaatcaaatttggatgaatatctgaaggatcctaagaaatatattccagga
actaaaatggtttttgttggactcaagaaagccgaggaccgcgctgatttgattgcctac
ctcaagcggggcaaatag

DBGET integrated database retrieval system