KEGG   Drosophila willistoni: Dwil_GK18205Help
Entry
Dwil_GK18205      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein
  KO
K08738  cytochrome c
Organism
dwi  Drosophila willistoni
Pathway
dwi04214  Apoptosis - fly
dwi04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Cellular Processes
  Cell growth and death
   04214 Apoptosis - fly
    Dwil_GK18205
   04215 Apoptosis - multiple species
    Dwil_GK18205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 6643456
NCBI-ProteinID: XP_002066278
FlyBase: FBgn0220204
UniProt: B4MYS5
Position
Unknown
AA seq 105 aa AA seqDB search
MGAGDADNGKKIFVQKCAQCHTIEAGGKHKVGPNLSGVVGRKCGTAPGYKYTDANISRGV
TWTESNLDEYLKDPKKYIPGTKMVFVGLKKAEDRADLIAYLKRGK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggggccggcgatgcagataatggcaaaaagattttcgttcagaaatgcgcccaatgt
cataccattgaagcgggtggcaagcataaagttggacccaatctaagcggagttgtggga
cgtaaatgcggcactgctccgggctacaaatatactgatgcaaatataagtaggggcgtt
acatggacagaatcaaatttggatgaatatctgaaggatcctaagaaatatattccagga
actaaaatggtttttgttggactcaagaaagccgaggaccgcgctgatttgattgcctac
ctcaagcggggcaaatag

DBGET integrated database retrieval system