KEGG   Drosophila willistoni: Dwil_GK18235Help
Entry
Dwil_GK18235      CDS       T01067                                 

Definition
(RefSeq) GK18235 gene product from transcript GK18235-RB
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dwi  Drosophila willistoni
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dwil_GK18235
   00053 Ascorbate and aldarate metabolism
    Dwil_GK18235
   00500 Starch and sucrose metabolism
    Dwil_GK18235
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dwil_GK18235
   00860 Porphyrin and chlorophyll metabolism
    Dwil_GK18235
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dwil_GK18235
   00982 Drug metabolism - cytochrome P450
    Dwil_GK18235
   00983 Drug metabolism - other enzymes
    Dwil_GK18235
Enzymes [BR:dwi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dwil_GK18235
Glycosyltransferases [BR:dwi01003]
 Others
  Hydrophobic molecule
   Dwil_GK18235
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 498 aa AA seqDB search
MSLIKALADRGHNITVVAALKPKLAPHENITVIVVPPSLEAQKMFNERVSKVTKEKTNVL
MALAKGFAQSNTMFQSQYDLTVHPKVKSIYENPQVKFDLLIIGYFMNDLQLGIAAKLNCP
VIINWCGVPFEMLDALVGNVNDPAHVPNFNMALEKGQKTMSFRFRVKNFITYTIFKGLNM
ILNYHMNNYYKQAFGVDPDFPTLNDMKRRISLLFMNYHSHSEGPIRPSVPQSVELGGIQI
KDTPDPLPKDLAEFLDNASTHGAIFFSLGSNIDTAYVKEEIIEHIYNVLSRLPQRVIWKW
SDLSKTPGSASNIYYHNWLPQDDILAHPNTKLFITHAGKGGLAEAQFHGVPMLALPIFAD
QPGNAASMVASGFGLSLELLTLTEKNFENSIHEILQNSTYKEKVGQFSSLYRDRPMTARK
TAVYWTEYVLRHQGAYHLQSPVIHMGFIARHNLDVYSLFILVIIALIWLLARILRFVFRK
VARLLHGRVYSYQKVKAN
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttgataaaggctttagctgatcggggacataatatcacagtggttgcggcattg
aagccaaaactagccccacatgagaatattacagtgatcgtagtgcctccaagcctggaa
gcccaaaaaatgttcaacgagcgcgtgtcaaaagttactaaagaaaagaccaatgtgcta
atggctcttgcaaagggctttgctcaatcaaatacaatgtttcaatctcaatatgacctt
actgtgcatccaaaagtaaagtccatctatgagaatcctcaagtcaaatttgatctactt
ataattggttattttatgaatgatttgcaattgggaatagctgcgaaattgaattgtccg
gttattatcaattggtgtggagtgccattcgaaatgttggatgccctagtgggcaatgtg
aacgatccagcacatgtgcctaattttaatatggccctggaaaagggtcaaaaaactatg
agtttccgtttccgagtgaaaaactttataacctatacaatatttaagggcctcaatatg
attttgaattatcacatgaataattattacaagcaagcctttggcgtggatccagatttt
cccaccctcaatgatatgaagcgtcgcatatctctgctgttcatgaactatcattctcat
agtgaaggacccatacggccatcggtgccacaatctgtggaattgggtggcatacaaatc
aaggatacaccagatcctttgccgaaagatctggcagaattcttggacaatgcatcgacg
catggagcaatcttctttagcttgggctctaacattgataccgcctatgtaaaagaggag
atcattgagcatatttataatgttctatcacgtctgccgcagcgtgtgatatggaaatgg
agtgatttgtcaaagacaccaggatcagcttccaatatttattatcacaactggttaccc
caagatgatatattggcccatccgaataccaaactatttataacccatgccggaaaaggt
ggcctggcggaagcccagtttcatggagttccaatgttggctttgcccatttttgccgat
caaccgggaaatgcagcttcaatggttgcctctggttttggcctctctctagaactacta
accctgactgagaaaaatttcgaaaactctattcacgagattttacaaaattcaacgtac
aaggaaaaggtggggcaattctcgtctttgtatcgtgataggccaatgacggcgcgcaag
acggctgtatactggaccgagtatgtgctacgtcaccaaggagcctatcacctgcagagc
cctgtgatacatatgggttttatagcacgacataatcttgatgtctactcattgttcata
cttgtaattatcgcattgatatggctactggctcgaatacttcgttttgtatttcgcaaa
gttgccagactattgcatggcagagtttattcttatcagaaggtaaaagcaaattag

DBGET integrated database retrieval system