KEGG   Drosophila willistoni: Dwil_GK18271Help
Entry
Dwil_GK18271      CDS       T01067                                 

Definition
GK18271 gene product from transcript GK18271-RA
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
dwi  Drosophila willistoni
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dwi00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dwi00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 955 aa AA seqDB search
MEETSTTTTTLRNGNAAAVGDVGVGVVNGIVAPDSASAVYEEKLKQEDPNEITAIPRYGL
KLKFDHVWPERRNQNLRPSIKQTLPMVPLVCRYAAYYWKVSREGRRVYMDYYYMENGKQI
YGVPIGGIGGGTIGRGYAGEFCRFQMRPGIYEYNTVLANQFIVTIKDQKGCTIFQSLLSK
CSSIINNNDTEADEDEKSRTKCQLPNCSSSRSRQPLSTWHSNIDDSRCSYTGLYPRSWTE
YDLSHYGVRLICRQISPVIPHDYKESSLPCAVFVWSAENVCDQERKVSITFTFKNGTGNK
KQDAEGGAESQLINEGHAKGVAIRQKIADMPCSYNLACRVLPDISITRCPQFDPAGNGEA
LWAQLKEHGQLSDEPTQETLKTKDIGVAVCAHIALKPQASHELEFVLAWDMPKIQFPRKL
KTHTRYYTKYFDDSGEAGPRICEYALKHYQSWERLIDAWQRPILNDEGLPEWYKCAIFNQ
LYFISDGGTIWLKCDSSLGKELAYDDPRLAYGRFGYLEGHEYRMYNTYDVHFYASPALAH
LWPNLQVSLQFDFKDAIAAELNDTRKMLYDGKIMPRKVKNCVPHDLGDPDEEPFTLINCY
NIHDVNEWKDLNTKFVLQVYRDYYVLNELAQAQADNASKFSSIEFIDKESLYELYSQDNK
RKNSADEKQQNRKSASMYINETNGKVYLMDAIGYLKSMYAACKAIMERTIEYDKDNDGLI
ENTKMPDQTYDSWVMDGPSAYCSGLWLASLQAMSAMATILDQPNDCLRYQDILEKGKHSL
EEKLWNGSYYRFDLSHSHRDTIMADQLCGHWYLKSCGFDYEIYPKENVRTALKRIYDNNV
MGFHDGNIGAANGFIANVSEPSKAGHVDNSNIQAEEVWPGVVYALAATMIQEGMFDEAFQ
TAGGMYKTISQRIGMNFETPEALYGEKRYRSIGYMRPLSIWSMQVAWERRRALRD
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaacgtcaacaacaacaacaacattgagaaacggtaatgcggcggcggttggc
gatgtgggtgtgggggttgttaacggaattgttgctccagactccgccagtgcggtatat
gaagagaaactaaagcaggaagatcccaatgagattaccgctattccgcgttatggcctc
aagctgaaatttgatcatgtctggccagagcggaggaatcagaatctgcgtccaagtatt
aagcaaacattgcccatggtgccgctggtatgcagatatgcggcctactactggaaagtg
tcgcgtgaaggtcgtcgtgtctatatggattattattatatggagaatggtaagcaaatt
tatggtgtacccattggtggcattggcggtggaaccatcggacgtggttatgctggcgag
ttttgtcgctttcaaatgcgtcccggcatctatgagtacaatacggtgctggccaatcag
tttatagtcaccatcaaagatcaaaagggctgcaccatatttcagagtttactctccaaa
tgcagctcaattattaataacaatgatacggaagctgatgaggatgagaaatcgagaact
aaatgtcaactgcccaattgcagcagcagtcgttcccgtcaacctctgagcacttggcat
tcaaatatcgatgattcccgatgcagttatacagggctatatccacgctcttggaccgaa
tatgatctctcgcattatggtgtacgtttgatatgtcgccagatatcaccggtcataccc
catgattataaagagtcaagtttaccctgtgccgtttttgtgtggagcgccgagaatgtc
tgtgaccaggagcgaaaggtttcaatcacatttaccttcaagaatggcactgggaataag
aaacaggatgccgagggtggtgctgaatcgcagttaattaacgaaggacatgccaaaggt
gtggccataaggcaaaagatagccgatatgccatgtagctacaatttggcatgtcgcgtc
ttgcccgatataagtattacgcgttgtccccagttcgatccggctggcaatggtgaagca
ctgtgggcacaattgaaagagcatggccagctaagtgatgagcctacccaggagacactc
aagaccaaggacattggcgtggcagtttgtgctcatattgcattaaaaccgcaagcatcg
catgaattggaatttgttttggcctgggatatgccgaaaattcaatttcctagaaaacta
aaaacccacacacgatattatacgaaatactttgacgattctggtgaggctggaccaaga
atttgtgaatatgctctcaagcattatcagagttgggaacgtcttatcgatgcctggcag
cgacctattctaaatgatgaaggtctgcccgaatggtataaatgcgccatattcaatcaa
ctttacttcatttccgatggcggaaccatttggctaaaatgtgactcttcgctgggcaag
gaattggcctatgatgatccacgcttggcctatggtcgttttggttatctcgagggacac
gagtatcgcatgtataatacttatgatgtccatttctatgcatcgccagccttggcccat
ctctggccgaatttgcaagtgagtttgcaattcgatttcaaagatgccattgccgccgag
ttaaatgatacacgcaaaatgctatacgatggcaaaataatgccacgaaaggttaagaat
tgtgtgccccatgatctgggtgatcctgatgaagaaccctttaccttaatcaattgctat
aacattcacgatgtgaatgagtggaaagatctcaatacgaaattcgtgctacaagtctac
agagattattatgtactcaatgaattggcccaggcccaggcggataatgccagtaaattt
agttcaattgagtttatcgataaggagagtttgtatgaactctattcccaggataataaa
cgcaaaaattcggcagatgaaaagcaacagaatcgcaaatctgcctcaatgtatatcaat
gagaccaatggaaaggtttatctcatggatgcaattggatatctgaaatctatgtatgct
gcctgcaaggccataatggagaggaccattgaatatgataaggataatgatggactcatt
gagaatacaaaaatgcccgaccaaacctatgattcttgggttatggatggaccaagtgct
tattgttctggcctctggttagcctcattgcaggcaatgtctgccatggccacgattttg
gatcagcctaacgattgcttgcgctatcaggatatactcgagaagggtaaacattcgctg
gaggagaaactctggaacggtagttactatcgatttgatctttcgcacagtcatcgcgac
acaataatggccgatcaattgtgtggccattggtatttaaagtcttgtggctttgattac
gaaatctatcccaaagagaatgttcgcacggcgttgaaacgtatttacgataacaatgta
atgggcttccatgatggtaacataggggcagcaaatggttttattgccaatgtcagcgaa
ccctcgaaagcgggtcatgtcgataatagcaacatacaggcggaagaagtatggcccggt
gtggtctatgccctggcagccaccatgattcaagagggaatgtttgatgaagctttccaa
acggctggcggcatgtataaaaccatttctcaacgaattggaatgaatttcgaaacgcct
gaagctttgtatggcgaaaaacgctatcgttctattggatacatgcgacccttgagcata
tggtctatgcaggttgcctgggagagacgtcgggcattgcgtgattaa

DBGET integrated database retrieval system