KEGG   Drosophila willistoni: Dwil_GK18290Help
Entry
Dwil_GK18290      CDS       T01067                                 

Gene name
Dwil_Adh
Definition
Alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
dwi  Drosophila willistoni
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:dwi01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dwi00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:dwi00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:dwi00350]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:dwi00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:dwi00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:dwi00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 254 aa AA seqDB search
MALTNKNIIFVAGLGGIGLDTSRELVKRDLKNLVILDRIDNPAAIAELKAINPKVTVTFY
PYDVTTPLTETTKLLKTIFAQLKTVDVLINGAGILDDHQIERTIAVNFTGLVNTTTAILD
FWDKRKGGPGGVICNIGSVTGFNAIYQVPVYSASKAAVVSFTQSIAKLANVTGVTAFTVN
PGITKTTLVHKFNSWLDVETRVAEKLLEHPTQTTLACAQNFVKAIELNKNGAIWKLDLGT
LEPIEWTKHWDSGI
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggctctcaccaacaagaacatcatctttgtggccggtctgggcggcattggtctggac
accagtcgcgaattggtcaaacgggatctcaagaacttggtgatcctggatcgtattgac
aatcctgctgccattgctgaactgaaggcaatcaatcccaaagtgacagttaccttctat
ccctatgatgttaccacacccttgacagagactaccaaattgttgaagaccattttcgcc
caattgaagactgtcgatgtcctgatcaatggagctggcattttggatgatcatcagatt
gagcgtaccattgctgtgaacttcactggtttggtcaataccaccacagccattttggac
ttctgggacaagcgtaagggtggaccaggtggtgtcatctgcaacattggctctgtgacc
ggtttcaatgccatctaccaggtccctgtctattccgcatccaaagcagctgttgttagc
ttcactcaatccattgccaaattggccaatgttacgggtgtgactgcatttaccgtgaat
cctggtattaccaagactacattggtccacaaattcaactcctggttggatgtggagacc
cgtgtggccgagaaattgcttgagcatcccacccaaacaactttggcctgcgcccagaac
tttgttaaggccattgaattgaacaagaacggtgccatctggaaattggatttgggcaca
ttggaacccatcgaatggaccaagcactgggattcgggcatttaa

DBGET integrated database retrieval system