KEGG   Drosophila willistoni: Dwil_GK18473Help
Entry
Dwil_GK18473      CDS       T01067                                 

Definition
GK18473 gene product from transcript GK18473-RA
Orthology
K11252  
histone H2B
Organism
dwi  Drosophila willistoni
Brite
Exosome [BR:dwi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dwil_GK18473
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKNDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccgccaaaaactagtggaaaagcagccaagaaggctggcaaggctcaaaagaacatc
accaagaatgacaaaaagaagaagcgcaagcgtaaggagagctatgctatttacatttac
aaagtgttaaagcaagtccacccagacactggtatttcttcaaaagcaatgagcataatg
aatagctttgtaaacgatatttttgaacgtattgctgctgaggcctcccgcttggcccac
tacaataagaggtcgaccatcaccagtcgcgaaatccaaacggctgttcgtttgcttttg
ccgggtgagcttgctaagcacgctgttagtgagggaacaaaagctgtcaccaagtatacc
agctcaaaataa

DBGET integrated database retrieval system