KEGG   Drosophila willistoni: Dwil_GK18741Help
Entry
Dwil_GK18741      CDS       T01067                                 

Definition
GK18741 gene product from transcript GK18741-RA
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
dwi  Drosophila willistoni
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Dwil_GK18741
Enzymes [BR:dwi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     Dwil_GK18741
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 918 aa AA seqDB search
MTLKLRIAIIGQSNFASDVLEIFLERSNIEIVGVFTIPDKGNREDILATTAKAHQIPVFK
FASWRRKGIAIPEVLEQYASVGANLNVLPYCSQFIPMEVIDGAALGSICYHPSILPRHRG
ASAISWTLIEGDEVAGFSIFWADDGLDTGPLLLTRQTNLEPTDTLDTIYKRFLYPEGVKA
MGVAVDLVAKGEAYKITQTEVGATYDPAMFKIENQVINLGQTAVRIWNFIRGLDSVPGAI
ATVVLNTGDEVVEEQVRLFGAHLYSAGPVSNAQPLRLKGLSKPALVHEGGLLIEGTDGAF
VNVRRLKRGSKVIAASDWFKQANQEPIKDFTEDELSKKHALASIWQAILKDSIEPSTDFF
AAGAGSMDVVRLVEEVKETFDVPLENEHVFMAPVFEEFFDQLVRILRQGSSSTGGNRKQV
PFKGFLLNANKREIQVPTQLFVNGEFVDAEGGRTLDIINPTDEKILAKVACASAADVDKA
VQAAHKAFYGAWKQVSARQRGQLMLKLADLMEQHKEELATIESVDSGAVYTLALKTHIGM
SIDAWRYFAGWCDKIQGNTIPVNPARPNNVLTFTRKEPIGVCGLVTPWNYPLMMLSWKMA
ACIAAGNTCLIKPAQTCPLTALKFAELAVLAGFPPGVINVLPGKGSDAGQAVADHHLVRK
LGFTGSTPIGKHIMKSCADSNLKKCSLELGGKSPLIIFADCDLDKAVKHGMSSVFFNKGE
NCIAAGRLFIEDRVHDEFVRRVVKDLRSMTIGDPLNRSTAHGPQNHKAHYDKLIEFCQRG
VEEGATLVYGGGPVPNLKGYFFTPTVFTNVEDDMFIAQEESFGPIMIISKFNASDVDSVM
HRANRTEYGLASGVFTKDISKALSFADRIEAGTVFVNVYNKTDVAAPFGGFKQSGYGKDL
GQEALNEYLKTKCVTIEY
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgactttgaaactacgcatagccattattggccaaagcaattttgcctctgatgttttg
gaaatatttttggaacgctcaaatattgaaatcgttggagtctttaccatcccggataaa
ggaaatcgcgaggacatcttggccaccacagcaaaggcccatcaaatacccgtcttcaaa
ttcgccagctggcgccgcaagggcatagccataccggaagttctagagcaatatgcgtct
gttggagcaaatttgaatgtcctgccatattgctctcaatttattccaatggaggtgatt
gacggcgctgccttgggcagtatctgctatcacccgtcgattctgccaaggcatcgtggt
gccagtgccatctcgtggaccttaatcgagggagacgaagtggcgggctttagtatattc
tgggcggatgatggcttggacacgggtccgttgcttctaacgcgtcagaccaatcttgag
ccaacagacacgctggacacgatttacaagcgattcctgtacccggagggggttaaggca
atgggagtagccgtggatttggtcgctaagggggaggcttacaaaattacacagactgag
gtgggagccacttatgatccggccatgtttaagatagaaaatcaagtaataaatctggga
caaacagcggtacgcatttggaacttcatcaggggcttggactcggtcccaggagccata
gccacggttgttctcaacactggagatgaagtggttgaagagcaagtgcgcctattcggc
gctcatctatactcggccggtccagtgtcaaatgcgcagcccctgcgtctgaaaggtctc
tctaagccagctttggttcatgaaggtggcctactgattgagggaaccgatggagcattt
gtgaatgtgcgtcgactgaaacgcggctcgaaggttattgccgccagtgattggtttaag
caggcgaatcaagaacccattaaggacttcactgaagacgagctgtccaaaaaacatgct
cttgcttccatttggcaagcgattctcaaagactctatcgaaccatcgaccgatttcttt
gctgctggcgctgggtccatggatgtggtgcgcctagtggaggaagtcaaggaaacgttt
gacgtgccactagaaaacgagcatgtttttatggctcctgtttttgaggagtttttcgac
cagctcgttaggatcttacgccagggatcttcgtctactggaggaaaccgcaagcaagtg
ccgttcaagggtttccttcttaacgcaaataagcgagagattcaagtcccaacccaactt
tttgttaatggagagttcgtggatgctgaaggcggacggactctagatattatcaatcct
acagacgaaaaaatactagccaaggtggcttgtgcctctgcagccgatgtggacaaggct
gttcaagcagcccacaaggccttctatggagcttggaagcaggtttcggccagacaaaga
ggccaattaatgcttaagctggctgatcttatggaacagcacaaagaggagctggccacg
atcgaatctgtggactctggagctgtctatactctggccttaaaaactcacatcggcatg
tccattgatgcctggcgctactttgccggctggtgtgacaaaatccagggcaacacgatt
cctgtcaatcctgcacggccaaacaatgtgctaacattcactcgcaaggagccaatcggg
gtatgcgggcttgtaacgccttggaactatcctctgatgatgctttcctggaagatggct
gcctgcatagcggctgggaacacttgtctaataaaacctgcccaaacgtgtcctttaaca
gcattaaagttcgccgaactagctgttttggctggattcccaccgggtgtaatcaatgtt
ctgcctggcaaaggctcagacgctggtcaggctgttgccgaccatcacctggtacgcaaa
ttgggttttacaggatccactcccattggcaagcacatcatgaagtcctgtgcagactcg
aatctcaaaaaatgctctctggagttgggcggcaaaagtcctctgatcatatttgcagac
tgtgaccttgacaaagcagtgaagcatggcatgtcttcggtgttcttcaacaagggcgag
aactgcatagcagccggccgtctcttcattgaggatcgagttcatgacgagttcgttcgc
cgtgtagtcaaggaccttcgttccatgaccataggagatcctttgaaccgttcgactgcc
catgggccacaaaatcacaaggcccactacgataagcttatcgaattctgtcagcggggt
gtcgaagagggcgccaccttggtctatggcggcggacccgtgccaaatctcaagggctac
ttcttcacgcccactgtttttaccaacgtggaggacgacatgtttatagctcaagaggaa
tcttttggccccataatgatcatttcgaagttcaatgccagcgacgtggattctgtgatg
catcgggccaatcgcactgaatatggccttgccagcggcgtcttcaccaaggacattagc
aaagccctcagttttgccgatcgtatagaggccggcaccgttttcgtgaatgtctacaat
aagaccgatgtggcagctccgtttggtggtttcaagcagagtggctatggaaaggatttg
ggtcaggaggctcttaatgaatatctcaagaccaagtgtgtgacaattgagtattga

  All links  
No link information was found.   
DBGET integrated database retrieval system