KEGG   Drosophila willistoni: Dwil_GK18744Help
Entry
Dwil_GK18744      CDS       T01067                                 

Definition
GK18744 gene product from transcript GK18744-RA
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
dwi  Drosophila willistoni
Brite
Ribosome [BR:dwi03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    Dwil_GK18744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 210 aa AA seqDB search
MLPMARSILNGLVQITRSSRGAAFHTSSLMGCKAADTESNNTGDNADTDADATESSTQSS
VPDVNDRTKVIPVESSIRYLKSAAYKQTYGDGFVWSQYRRNHKGMYAPRKTRKTCIRQGK
ISTGNPCPICRDEYLVLDHRNTELIDQFISPHSGEVLSYSKTGLCQKSHLRLLVAVQRAR
DYGLLTYDVPFREYDYSEYYGQPKQKQQKS
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgttgccgatggcacgaagtattctcaatggactcgtccagataactcggagtagccgc
ggcgctgcctttcatacatccagcttaatgggatgtaaagctgctgatactgaaagtaat
aacactggagacaatgcggatacggatgccgatgccaccgaatcgagcacacaaagctcc
gttccagatgtcaatgatcgcacaaaagttattcctgtagagtcgtcgatacggtatctg
aagagtgcggcatataagcaaacctatggcgatggtttcgtatggtcgcaataccggcgt
aaccacaaaggtatgtatgccccacgtaagacacggaagacatgcatacgccaaggcaaa
atctccactggtaatccctgccccatttgccgggatgaatatctggtattagatcatcgc
aatacggaactgattgatcaattcatatccccacacagtggtgaggttttgagctattcg
aaaacgggtctgtgccagaagagtcatttgcgcttgttggttgccgtccaacgggctcgt
gattacggtctactcacctatgatgtaccattcagagaatacgattacagcgagtactac
ggccaaccaaaacagaaacaacaaaagtcttga

DBGET integrated database retrieval system