KEGG   Drosophila willistoni: Dwil_GK18744Help
Entry
Dwil_GK18744      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein
  KO
K16174  small subunit ribosomal protein S18b, mitochondrial
Organism
dwi  Drosophila willistoni
Brite
Ribosome [BR:dwi03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    Dwil_GK18744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S18 RecR TF_Zn_Ribbon
Motif
Other DBs
NCBI-GeneID: 6646749
NCBI-ProteinID: XP_002069416
FlyBase: FBgn0220742
UniProt: B4N7R3
Position
Unknown
AA seq 210 aa AA seqDB search
MLPMARSILNGLVQITRSSRGAAFHTSSLMGCKAADTESNNTGDNADTDADATESSTQSS
VPDVNDRTKVIPVESSIRYLKSAAYKQTYGDGFVWSQYRRNHKGMYAPRKTRKTCIRQGK
ISTGNPCPICRDEYLVLDHRNTELIDQFISPHSGEVLSYSKTGLCQKSHLRLLVAVQRAR
DYGLLTYDVPFREYDYSEYYGQPKQKQQKS
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgttgccgatggcacgaagtattctcaatggactcgtccagataactcggagtagccgc
ggcgctgcctttcatacatccagcttaatgggatgtaaagctgctgatactgaaagtaat
aacactggagacaatgcggatacggatgccgatgccaccgaatcgagcacacaaagctcc
gttccagatgtcaatgatcgcacaaaagttattcctgtagagtcgtcgatacggtatctg
aagagtgcggcatataagcaaacctatggcgatggtttcgtatggtcgcaataccggcgt
aaccacaaaggtatgtatgccccacgtaagacacggaagacatgcatacgccaaggcaaa
atctccactggtaatccctgccccatttgccgggatgaatatctggtattagatcatcgc
aatacggaactgattgatcaattcatatccccacacagtggtgaggttttgagctattcg
aaaacgggtctgtgccagaagagtcatttgcgcttgttggttgccgtccaacgggctcgt
gattacggtctactcacctatgatgtaccattcagagaatacgattacagcgagtactac
ggccaaccaaaacagaaacaacaaaagtcttga

DBGET integrated database retrieval system