KEGG   Drosophila willistoni: Dwil_GK18789Help
Entry
Dwil_GK18789      CDS       T01067                                 

Definition
GK18789 gene product from transcript GK18789-RA
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.1.2.15]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dwil_GK18789
Peptidases [BR:dwi01002]
 Cysteine Peptidases
  Family C67
   Dwil_GK18789
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 577 aa AA seqDB search
MNNPSNKSLDLADLLGTNWPSHVGAVAAILNRDQSGTKQNDGVNSLNISPGVTVNQESMH
DTNLVGEDAYEIPGTSLTVGSLVEVADSELSDELYGVIRWIGLPSQSSNNLLIGIELEDD
VVNLKHLSTSNGSYNGIRLFECNEGRALFVPPSKCSIDRRFIDIDSSPSGNKITNDSQSI
TFGIMDCPYVLGSVPPLKVCNSEELNNICGKFKGIQGHHNSCYLDATLFSMFTFTSVFDS
ILYRCSGPQDIAHYSSVQKVLRDEIVNPLRKNLYVRADRVMQLRKLLDQLSSVSGLTSEE
KDPEEFLNSLLAQIMRVEPFLKLSSGQDSYFYQLFVEKDERLTFPTVQQLFEQSFHSSSI
KLKEVPSCLIIQMPRFGKNYKMYPRILPSQVLDVTDIIEDSPRQCSVCGKLAEHECGQCY
GSLQSGSGLECTAFCQKCLETVHLHSKRTTHVTKKIFAPRDYKIMADHIVIPRLYMELFA
VVCIETSHYVSFVKAGSGPDAPWCFFDSMADRKGGKNGYNIPEIIVVNELPLWLSDEGSR
SINETSKNVKALPEHAKRLFCDAYMCMYQSTDVMMYN
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatccgtcaaacaaaagtctggacttggcggatcttttggggacaaactggccc
tctcatgtaggagcggttgctgcaatcttaaacagagaccaaagcggaaccaagcagaat
gatggggtaaattcactaaatatctctcctggcgtgacagtgaatcaagaatctatgcat
gatacaaatctggttggtgaagatgcctatgaaatacccggaacttctcttacggttgga
tctctcgttgaagtagctgattccgaactatctgatgagctatatggtgtcattcgatgg
attggattaccttcccaatcatctaataacttactcataggaattgaacttgaagatgac
gtagtaaatttgaaacatctttcaacctccaatggaagctataatgggattcggttattt
gagtgcaatgaaggtcgtgcattgtttgttccgcccagcaagtgtagcatagaccgacga
tttattgacattgatagcagcccttccggaaacaagattaccaatgactctcagtcaata
acgtttggcatcatggattgcccatatgttttgggatctgttccgcctttaaaagtttgt
aactcagaggaactgaataatatttgtggaaaatttaagggcatacaaggtcaccacaat
tcttgctatttggacgctactttgttttctatgtttacatttacaagcgtgtttgactca
atcctgtataggtgttcgggaccacaggatatagctcactacagctccgtgcagaaagtt
ttacgtgatgaaattgtcaatccattacgaaagaatctttatgtgagggcggaccgcgta
atgcagctacgcaagctattagatcaactaagttcagtaagcggcttaacaagcgaggag
aaggatcctgaagaatttctaaacagtttgctagcacaaataatgcgtgtagagcccttt
ttaaaactaagctctggacaggactcatatttttatcaactatttgtagaaaaagacgaa
cgattaacttttcccactgttcagcaactattcgaacagagttttcattcgtctagtatc
aagttaaaggaggttccttcctgtcttattattcaaatgccacgctttggaaagaattac
aaaatgtatccgcgaattttgccgtcacaagtcttagatgttacggacattattgaagac
tcacctcgtcaatgttctgtttgcggaaaattagcagaacatgaatgcggtcaatgctat
ggaagcttacaatccggctcaggccttgagtgtactgcattttgtcaaaaatgtcttgaa
acagtacatctacactccaaaaggactacacacgtaacaaaaaaaatatttgctccaagg
gattacaaaattatggctgatcacattgttatacctcgactttatatggaattatttgct
gttgtatgtatagaaacatcacattatgtatcgtttgttaaagctggctctggaccagac
gctccttggtgcttctttgactcaatggcggatagaaaaggcggaaaaaatggatataac
atacctgaaattatagttgttaacgaattgcctctctggctttccgacgaaggttcgcga
tctattaatgaaacttcaaagaatgttaaggctttacccgagcacgccaagcgtctcttt
tgcgatgcttacatgtgtatgtatcagagtactgacgttatgatgtataactaa

DBGET integrated database retrieval system