KEGG   Drosophila willistoni: Dwil_GK19081Help
Entry
Dwil_GK19081      CDS       T01067                                 

Definition
GK19081 gene product from transcript GK19081-RA
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     Dwil_GK19081
    1.3.1.94  polyprenol reductase
     Dwil_GK19081
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 324 aa AA seqDB search
MWWLSLISSLEEFIDRYNINLIQVNFFGFIITMVIFGGLMTLIESHLPNSFRQWFRYGKH
SHKGETDALVSRLEVPKGWFKHFYIFALVWSLWALYLIVNCITRQQAAPEYALRFLDFMC
GGSSNRVAQVDSNTALVGTVLLTLQCFRRFYETNFVQIFSKHSKMNLSHYTVGYIHYFGA
IVSLLSHTTGFVRGTAPNEFTLKNISLLQGLYILIFLFSWHQQYASNIILVNLRKDQKTG
SVKTERHLLPKGGWFNLISSPHMFFEIVMYYCLSDIYAPIRTWKLIFLWVASNQTVNALL
THQWYKENFKDYPKRRHAIVPFLL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggctctctcttatcagctccctggaggagttcatcgataggtacaacattaat
ttaattcaagtgaatttctttggattcatcataactatggtgatctttggcggtcttatg
accctaatagagtcacatttgcctaacagttttcggcaatggtttcgttacggcaagcac
agccataagggagaaaccgatgcactggtcagtcgtttggaggtacccaaaggatggttc
aaacatttctatatatttgccttggtctggtcgttgtgggcattgtatttgattgttaac
tgcatcactcgtcagcaggcagcccccgagtatgccctacgtttcctggactttatgtgt
ggcggctctagcaatcgtgtagcccaagtggactcgaatacggctctggttggcaccgta
ttgctaacactgcaatgttttcgtcgattttatgaaacgaattttgtgcaaattttctcc
aagcacagtaaaatgaatctttcgcactatacagtgggctatattcattattttggagcc
attgtatccctgctgtcccacacaacgggctttgtacgaggaacagcaccaaatgaattc
actttaaagaatatttcactcctccaaggactttacattctaattttcctcttttcctgg
catcaacaatacgctagtaatataatcttggtcaatctgcgtaaggatcaaaagacgggt
tcagtgaagacagagaggcatctattacccaagggtggttggtttaatttaatctcctca
ccacatatgttcttcgagattgtaatgtactattgtctgagcgatatatatgcaccgatc
cgcacatggaaactgatattcttgtgggtggccagcaatcaaactgtaaatgccctgctc
acccatcaatggtacaaagagaatttcaaggattacccgaaaaggaggcatgcaattgtt
ccttttctactgtaa

DBGET integrated database retrieval system