KEGG   Drosophila willistoni: Dwil_GK19311Help
Entry
Dwil_GK19311      CDS       T01067                                 

Definition
GK19311 gene product from transcript GK19311-RA
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dwi  Drosophila willistoni
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Dwil_GK19311
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dwil_GK19311
Enzymes [BR:dwi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Dwil_GK19311
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 194 aa AA seqDB search
MDKLGKFYGFVLTLTVTVTLVTHCNLQRKLVEMNRARQSVYALAVLDTFGRTVELKRYMG
HVLLIVNIASRCGLTDKQYAGLAQLRETYEADGLRILNFPCNQFGQQMPESDGKAMIEHL
IKRNLQIGDIFAKIHVNGPQANPLYRKLAGHKPIEWNFAKFLIDHHGLVYKRYEPTTEPS
ELVKDIEWLLLESI
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggataaactgggcaaattctacggctttgtgctgaccctaactgtgacggtaactctt
gtgactcattgcaatttacagaggaaactggttgagatgaatcgtgcgagacagtcggtg
tatgcattagccgtattggatacctttggtcggacagtggaactgaagcgatatatgggc
catgtgttgcttattgtcaacattgcctctcgttgtggactcaccgacaagcaatatgct
ggcctagcccagctaagggagacatacgaggccgatggtctacgtatactcaattttcca
tgcaatcaatttggtcagcaaatgcccgaatcagatggcaaagcgatgatagaacatttg
attaaaagaaatctacaaattggtgatatctttgccaaaatacatgtgaatgggccgcag
gctaatccactctatagaaagcttgctggtcataagccgattgaatggaattttgcaaaa
tttcttatagatcaccatgggttggtctacaagcgttatgagccaacaacagagcccagt
gaattggttaaagatattgaatggttgttgttggaaagcatatga

DBGET integrated database retrieval system