KEGG   Drosophila willistoni: Dwil_GK19456Help
Entry
Dwil_GK19456      CDS       T01067                                 

Definition
GK19456 gene product from transcript GK19456-RA
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
dwi  Drosophila willistoni
Pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:dwi04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 283 aa AA seqDB search
MSRVLPCVSLGLLVLLALEVSSLPLQDEPIDPRIVGGYETDVALCPYQLSLRRKAITAPQ
NAFSHVCGASIIAEDIAITAAHCISATVPSQWKVVAGTNYRNETDGVIVSVSQIIMHEQY
YKEARYDNDVALLVLNPSLPLNNHNIKAIPLASEPPLAGAMSKISGWGTTTYRGSSSYVL
LAVDVPIVSNEVCDADYEDYEDGLFNITSSMLCAGVRGVGGKDACQGDSGGPLVVNRQLA
GVVSWGAECALAEYPGVYANVPNLRPWIDAKLAEITLLRKKLN
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcgttttaccttgtgtttcactcggacttctggtgctattggccttggaagtt
tcatcgctacctttgcaggacgaaccaatcgatccgcgtattgtcggcggctatgaaact
gatgttgccctctgcccctatcagttatcgttgcgtcgtaaggctataaccgcaccgcaa
aatgccttttctcatgtttgcggggcttcgattatagccgaagatattgcaattacagca
gctcattgcatttcggcaactgtaccaagccaatggaaagttgtggctggcacaaattat
cgtaatgaaacagatggcgtgattgtttccgtctcgcagatcataatgcatgagcaatac
tacaaagaggcacgctacgacaatgatgtggcccttttggtccttaatccttcattgcca
ttgaataatcataacatcaaagccattcccttggctagtgagccaccattggcgggtgcc
atgagtaaaataagtggttggggcaccaccacataccgtggctcatcctcctatgtccta
cttgccgtcgatgtgccaatagttagtaacgaagtctgtgatgccgattacgaggactat
gaggatggtctctttaacataaccagctcgatgctgtgcgctggtgttcgtggtgttggt
ggtaaagatgcctgccagggagattccggaggtcctcttgtagttaatcgtcaattggct
ggcgttgtatcctggggcgctgaatgtgccttggccgaatatcctggcgtctatgctaat
gtgcccaatttaagaccctggatcgatgcaaaacttgcagaaattacattgctacgaaaa
aaattaaattga

DBGET integrated database retrieval system