KEGG   Drosophila willistoni: Dwil_GK19496Help
Entry
Dwil_GK19496      CDS       T01067                                 

Definition
GK19496 gene product from transcript GK19496-RA
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dwi  Drosophila willistoni
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dwi00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 596 aa AA seqDB search
MNNGRYGRFGALIGISYVSGTHCRFLIYSTRNAEVLAFHELKLRQIVHQAGWLEYDPSEI
YKSMQECIEIAYKNLVILEINPHDIIAVGIVNQRGTTVLWNKQTGQALHNAIAWCDSRST
PLLKTCLHNNNNNVDYVRHRSGLPLSSCFSALKIRWLLENVPAVGKTIEEDKCLFGTLDS
WLLWNLTGGVNVGIHSTDITNAHYTGLMNLTSQQWDAKLCKFFKLPIDILPRIRSNSEIY
GYVLEGPLLGVPIAGVMGEQPAAMLGQLCLKPGQNICTLDDSCFVLLNTGRQLLASQNGL
ISGIAYKLGAQTETCYTLEGAISNAGSTVNWLRQRLKINTEINSNDNVMESLTTFLGESS
MISSSCSSSMLNVECGLAAKRSEVTFVPAFHGLYAPYWRYDARGILLGLTSQTTAENITQ
AAYEATGFQIYEVLQAFKKDTPNWDHSRMQPVLTFGGDYAESTHLVQFISDIIGYMLERP
QTTSPSGLGVMIAAGITMRAVSLEYAIKMYAPPTDVYAPTTTPNRRELLYRRWDYAVKRC
LNWNNYETYESDIELFAQREHDPNFSIRRSLPGSLFITTSFALFLLANYLKNNPLS
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaataacggtcgctatggcagatttggagcactcattggcatttcatacgtgagcggc
acgcattgccgttttctgatctattccactcgcaatgcagaagtactggctttccatgag
ttaaaattacgtcaaatagttcaccaggctggctggttggagtacgatccatccgagata
tacaaatcgatgcaagagtgcatagagattgcctataagaatttggttatactggaaatc
aatccgcatgacatcatagccgtgggtatagtcaatcagcgaggcaccactgtcctatgg
aacaaacaaactggtcaggccctacataatgccatcgcctggtgcgattctcggtctact
cccttgctgaagacttgtcttcataataataataataacgtggactatgtgagacatcgc
agtggtctcccgctgagtagctgctttagcgccctgaaaatccgttggctactagaaaat
gttcctgcagtgggcaaaacaattgaggaagataaatgtctatttgggactttggactct
tggctgttatggaatttaacgggcggcgtaaatgttggaatacactccacagatatcacc
aatgctcactatacgggtctaatgaatctgaccagccaacaatgggatgccaaactatgt
aaattttttaaacttccaatcgatatactgccccgtatacgttccaattctgagatctat
ggctatgtgctggagggtccattgctgggtgtgcccattgctggagttatgggtgaacaa
ccggctgctatgctgggtcaactgtgcctaaagccgggacagaatatttgcacgttggat
gacagttgctttgttctcctcaatacgggacgacaattgttggcatcgcaaaatggactg
attagtggaattgcttataaacttggtgcgcagacggagacatgctacactctggagggg
gccatttccaatgcaggatcaacagtaaattggttacgccagcgtctgaagattaatacc
gaaatcaattccaatgacaatgtaatggagtcactaaccacatttttgggggagagttcc
atgatatcgtcttcgtgttcatcttctatgttgaatgtggaatgcggtttggctgccaaa
cgatcagaggtaacatttgttcccgcatttcatggtctatatgctccttattggcgttac
gatgctaggggtatactcttgggcttaaccagtcagacgacagcggagaatataacccaa
gcggcatatgaggctacaggatttcaaatctatgaagtacttcaggcatttaaaaaggat
acacccaactgggatcattcgcgcatgcagcctgtattgacctttggcggggattatgcc
gagagcacgcatctggtacaatttatatcagatattattggttatatgctggagaggccg
cagactacttcgccatcgggattgggtgttatgatagctgctggaattacaatgcgagcg
gtcagtttggaatatgccatcaaaatgtatgcgccacccacagatgtctatgctcccaca
accacaccgaatagacgtgagttgctttatcgtcgctgggactatgcagttaaacgttgc
cttaactggaacaattatgagacctacgaatcggatatagagctatttgctcaacgtgaa
catgatcccaatttttctatacgacgatctctgccgggaagcttatttataaccacttcc
tttgcgttatttttgttggccaactacctaaaaaacaatcccttgagttaa

DBGET integrated database retrieval system