KEGG   Drosophila willistoni: Dwil_GK19496Help
Entry
Dwil_GK19496      CDS       T01067                                 

Definition
GK19496 gene product from transcript GK19496-RA
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dwi  Drosophila willistoni
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dwil_GK19496
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Dwil_GK19496
Exosome [BR:dwi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dwil_GK19496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 596 aa AA seqDB search
MNNGRYGRFGALIGISYVSGTHCRFLIYSTRNAEVLAFHELKLRQIVHQAGWLEYDPSEI
YKSMQECIEIAYKNLVILEINPHDIIAVGIVNQRGTTVLWNKQTGQALHNAIAWCDSRST
PLLKTCLHNNNNNVDYVRHRSGLPLSSCFSALKIRWLLENVPAVGKTIEEDKCLFGTLDS
WLLWNLTGGVNVGIHSTDITNAHYTGLMNLTSQQWDAKLCKFFKLPIDILPRIRSNSEIY
GYVLEGPLLGVPIAGVMGEQPAAMLGQLCLKPGQNICTLDDSCFVLLNTGRQLLASQNGL
ISGIAYKLGAQTETCYTLEGAISNAGSTVNWLRQRLKINTEINSNDNVMESLTTFLGESS
MISSSCSSSMLNVECGLAAKRSEVTFVPAFHGLYAPYWRYDARGILLGLTSQTTAENITQ
AAYEATGFQIYEVLQAFKKDTPNWDHSRMQPVLTFGGDYAESTHLVQFISDIIGYMLERP
QTTSPSGLGVMIAAGITMRAVSLEYAIKMYAPPTDVYAPTTTPNRRELLYRRWDYAVKRC
LNWNNYETYESDIELFAQREHDPNFSIRRSLPGSLFITTSFALFLLANYLKNNPLS
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaataacggtcgctatggcagatttggagcactcattggcatttcatacgtgagcggc
acgcattgccgttttctgatctattccactcgcaatgcagaagtactggctttccatgag
ttaaaattacgtcaaatagttcaccaggctggctggttggagtacgatccatccgagata
tacaaatcgatgcaagagtgcatagagattgcctataagaatttggttatactggaaatc
aatccgcatgacatcatagccgtgggtatagtcaatcagcgaggcaccactgtcctatgg
aacaaacaaactggtcaggccctacataatgccatcgcctggtgcgattctcggtctact
cccttgctgaagacttgtcttcataataataataataacgtggactatgtgagacatcgc
agtggtctcccgctgagtagctgctttagcgccctgaaaatccgttggctactagaaaat
gttcctgcagtgggcaaaacaattgaggaagataaatgtctatttgggactttggactct
tggctgttatggaatttaacgggcggcgtaaatgttggaatacactccacagatatcacc
aatgctcactatacgggtctaatgaatctgaccagccaacaatgggatgccaaactatgt
aaattttttaaacttccaatcgatatactgccccgtatacgttccaattctgagatctat
ggctatgtgctggagggtccattgctgggtgtgcccattgctggagttatgggtgaacaa
ccggctgctatgctgggtcaactgtgcctaaagccgggacagaatatttgcacgttggat
gacagttgctttgttctcctcaatacgggacgacaattgttggcatcgcaaaatggactg
attagtggaattgcttataaacttggtgcgcagacggagacatgctacactctggagggg
gccatttccaatgcaggatcaacagtaaattggttacgccagcgtctgaagattaatacc
gaaatcaattccaatgacaatgtaatggagtcactaaccacatttttgggggagagttcc
atgatatcgtcttcgtgttcatcttctatgttgaatgtggaatgcggtttggctgccaaa
cgatcagaggtaacatttgttcccgcatttcatggtctatatgctccttattggcgttac
gatgctaggggtatactcttgggcttaaccagtcagacgacagcggagaatataacccaa
gcggcatatgaggctacaggatttcaaatctatgaagtacttcaggcatttaaaaaggat
acacccaactgggatcattcgcgcatgcagcctgtattgacctttggcggggattatgcc
gagagcacgcatctggtacaatttatatcagatattattggttatatgctggagaggccg
cagactacttcgccatcgggattgggtgttatgatagctgctggaattacaatgcgagcg
gtcagtttggaatatgccatcaaaatgtatgcgccacccacagatgtctatgctcccaca
accacaccgaatagacgtgagttgctttatcgtcgctgggactatgcagttaaacgttgc
cttaactggaacaattatgagacctacgaatcggatatagagctatttgctcaacgtgaa
catgatcccaatttttctatacgacgatctctgccgggaagcttatttataaccacttcc
tttgcgttatttttgttggccaactacctaaaaaacaatcccttgagttaa

DBGET integrated database retrieval system