KEGG   Drosophila willistoni: Dwil_GK19577Help
Entry
Dwil_GK19577      CDS       T01067                                 

Definition
GK19577 gene product from transcript GK19577-RA
Orthology
K14298  
mRNA export factor
Organism
dwi  Drosophila willistoni
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dwil_GK19577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 348 aa AA seqDB search
MFGATQSTNRMNDFEVASPPDDSVSALEFSPSTMQMQKNFLIAGSWDNSVRCWEVEQNGV
TVPKSMKTMGGPVLDVSWSDDGSKVFVASCDKQVKLWDLASDQVMQVAAHDGPVKTCHMV
KGPNYTCLMTGSWDKTLKFWDTRSPNPMMAINLPERCYCADVDYPMAVVGTAGRGLIIYS
LQNSPTEYKRQESPLKYQHRTISIFKDKKKEPTGYALGSIEGRVAIQYVSPVNPKDNFTF
KCHRSAGSSGFQDIYAVNDIAFHPIHGTLVTVGSDGTFSFWDKDARTKLKSSEAMDQSIT
KCAFNANGQIFAYAVGYDWSKGHEYFNPAKKPQIFLRSCFEELKARIN
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtttggagccacacaatccacaaatcggatgaatgacttcgaggtggcctcgccgccg
gacgattcggtgtccgccttggagttcagtccgagcacaatgcaaatgcagaagaatttt
ctcattgccggcagctgggataacagcgtgcgctgctgggaggtagagcaaaatggagtt
acggtgccaaagtctatgaaaacaatgggtggcccagtgttagatgtaagctggagcgat
gatggcagcaaagtctttgtggccagctgcgacaaacaagtgaaactctgggatttggca
tccgaccaggtgatgcaagtagcggctcacgatggcccagtaaagacatgccatatggtt
aaaggtccgaattatacatgcctgatgaccggatcctgggataagacactaaagttttgg
gatacacgttcacccaatcccatgatggctatcaatctgcccgaacgctgctattgtgcc
gatgtagactatcccatggctgtggtgggcacggcgggtcgtggcctaataatttactca
ctccagaacagtcccacagaatacaagcgacaggagagcccgctgaaatatcaacatcgc
accatatcaattttcaaagacaagaaaaaagagcccactggctatgccctgggcagtatt
gaaggtcgcgtggctatacagtatgttagcccagtcaatcccaaggataatttcactttc
aagtgccatcgatcagctggatcatcgggctttcaggatatttatgctgtcaatgatata
gccttccatcccatccatggaactctggttacagttggctctgatggcacatttagtttc
tgggacaaagatgcccgcaccaaactaaagtccagcgaggctatggatcaatcaattacg
aaatgcgctttcaatgccaatggacagatattcgcctatgccgttggctatgactggtcc
aagggacatgagtatttcaatccggctaagaaaccacagatcttccttcgttcctgcttt
gaggaactgaaggcgcgaattaactga

DBGET integrated database retrieval system