KEGG   Drosophila willistoni: Dwil_GK19694Help
Entry
Dwil_GK19694      CDS       T01067                                 

Definition
GK19694 gene product from transcript GK19694-RA
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
dwi  Drosophila willistoni
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dwil_GK19694
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     Dwil_GK19694
Peptidases [BR:dwi01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dwil_GK19694
Exosome [BR:dwi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dwil_GK19694
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 265 aa AA seqDB search
MVFPAVSSTLLFLLLLRFAEVQGGVFNERIVGGDELAIHNSPWQVSIQISARHECGGVIY
SQEIILTAAHCIKDKSTTLMKVRVGANQHNFGGTLIPVTAYKIHEKYDSKYLHYDIAVVR
LSETLTFSLNIKAINLASESPVGGSSVSVTGWGSQQEDSGYSGYADGLQTAQLEIIAREE
CASTKYGYGWDFVGEEMICAASSSSSERLSDACTGDSGGPLTTTTPVLLVGLVSWGYGCG
QINYPGVYIDVAILRPWIVKAANAV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggttttcccagcagtttcatccactttattatttttactcctactgcgattcgcggag
gttcaaggaggagtctttaacgaacgcattgtgggcggagatgaactggctatacataat
tcaccctggcaggtctccatacagatcagtgcccggcatgaatgtggaggtgtcatctac
agtcaagagattatcctcacagctgcccattgtatcaaagacaagtctacgactctgatg
aaagtacgcgtgggagccaatcaacacaattttggaggcaccctaataccagtgacggcc
tacaagatccatgagaaatacgattccaagtatttgcactatgacattgctgtggtacga
ctatcggaaaccctgacatttagtctaaatatcaaagcaatcaatttggccagcgaaagt
cctgtggggggcagcagtgtatccgtgaccggttggggatctcagcaggaggattctggc
tatagcggttatgccgatggcctgcaaacggctcaactggagattattgcacgcgaagaa
tgtgcttcaaccaagtacggatatggctgggattttgtgggtgaggaaatgatttgtgcc
gcttcttcatcaagctctgaacgtcttagcgatgcctgcactggcgactctggtggtcca
ctgacaaccacaacaccagtgcttcttgtaggtcttgtctcttggggatatggatgtgga
cagatcaattatcctggtgtctatattgatgtggctattctacgtccctggatagttaaa
gcagcaaatgcagtataa

DBGET integrated database retrieval system