KEGG   Drosophila willistoni: Dwil_GK19694Help
Entry
Dwil_GK19694      CDS       T01067                                 

Definition
GK19694 gene product from transcript GK19694-RA
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
dwi  Drosophila willistoni
Pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:dwi04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 265 aa AA seqDB search
MVFPAVSSTLLFLLLLRFAEVQGGVFNERIVGGDELAIHNSPWQVSIQISARHECGGVIY
SQEIILTAAHCIKDKSTTLMKVRVGANQHNFGGTLIPVTAYKIHEKYDSKYLHYDIAVVR
LSETLTFSLNIKAINLASESPVGGSSVSVTGWGSQQEDSGYSGYADGLQTAQLEIIAREE
CASTKYGYGWDFVGEEMICAASSSSSERLSDACTGDSGGPLTTTTPVLLVGLVSWGYGCG
QINYPGVYIDVAILRPWIVKAANAV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggttttcccagcagtttcatccactttattatttttactcctactgcgattcgcggag
gttcaaggaggagtctttaacgaacgcattgtgggcggagatgaactggctatacataat
tcaccctggcaggtctccatacagatcagtgcccggcatgaatgtggaggtgtcatctac
agtcaagagattatcctcacagctgcccattgtatcaaagacaagtctacgactctgatg
aaagtacgcgtgggagccaatcaacacaattttggaggcaccctaataccagtgacggcc
tacaagatccatgagaaatacgattccaagtatttgcactatgacattgctgtggtacga
ctatcggaaaccctgacatttagtctaaatatcaaagcaatcaatttggccagcgaaagt
cctgtggggggcagcagtgtatccgtgaccggttggggatctcagcaggaggattctggc
tatagcggttatgccgatggcctgcaaacggctcaactggagattattgcacgcgaagaa
tgtgcttcaaccaagtacggatatggctgggattttgtgggtgaggaaatgatttgtgcc
gcttcttcatcaagctctgaacgtcttagcgatgcctgcactggcgactctggtggtcca
ctgacaaccacaacaccagtgcttcttgtaggtcttgtctcttggggatatggatgtgga
cagatcaattatcctggtgtctatattgatgtggctattctacgtccctggatagttaaa
gcagcaaatgcagtataa

DBGET integrated database retrieval system