KEGG   Drosophila willistoni: Dwil_GK19779Help
Entry
Dwil_GK19779      CDS       T01067                                 

Definition
(RefSeq) GK19779 gene product from transcript GK19779-RB
  KO
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dwil_GK19779
Peptidases [BR:dwi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dwil_GK19779
Ubiquitin system [BR:dwi04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dwil_GK19779
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 1157 aa AA seqDB search
MVKKRQTDVHENGSSTDTGDEENHHHQAGGATNLSTGSASACQHIKKSVDATKLRRQIKL
TGLLYECSQCQKIKSGGDATPDPSASFEYDNTLWLCLKCGTQLCGRARNQHALQHYQTPH
SDSHSLAMNTRSFVIWCYECDNEVSSNSRKNLLECVELVKRLAQKPPTGLTNASVAPSLP
SESPPPPTTISNIESKIKTALKQIGPMVPMTGGQQQQQNQKEQHQVAIPLPPPPPAAVPG
MAKRVDVVGTGAAAAGSAGAKRGDVIITKVGSAVEIDRLPTVRGLTNLGNTCFFNAVMQC
LAQTPFLLSVLKELSEPGEEFVLPGGSFSFKDKGNIELPMIRGTLSSWGGLTAALANALE
ELQGRGGVFTPSKLFDKLCAKCPQFTGGDQHDAHELLRQLLESVRNEDLKRYQRVILQNL
GYKDQDINSVSEEMRQKCKIYGNQAGDRILRPEQVFRGFLVSTLTCQDCFNISSRHEYFL
DMSLPVAVEKPQPPQRRKPSPENNAVSMTTSSTNTSNLSPNQNQMNAKLNSASNGGIYQA
NDGDDAKQPFFLHTKTEDEQLGQQQGPTKSQLKKEKERERKANRAAKHQRHKQAQKLALK
VNGNANGEPATEPTAGGGDAASAAPSATTTNDDDDELPREADTLSSSVTTSEHSDADVED
NLQEDTTTTNTATTSTSTTTTAQAKFYTDKNGNAQPAALVGEKRDDTPDHMDKDSLEEDE
NDSGIATSPAPTTITTSNATAATNNGNATSSSSMSTSATSRADDESTAASLVTAGLSEKG
ASLIRQISIGNGTTNGISTAADPNGIQLAAAQLEQLKLREQAGQSGGALGGSGGGSGGGG
VRSKRVRTQSYSDWSTTIAPRYQCEDGECSVQSCLNNFTAVELMTGQNKVGCESCTKRLN
GPDPKAKSVNTNATKQLLISSPPAVLILHLKRFQLGPRCIFRKLTRAVTYPMLLDVAAFC
GSKVKNLPNIDRKQKKLLYALYGVVEHSGGMYGGHYTAFVKVRPKLMPDDKRWKFLPHGS
KAELDQDDDQLKKLEELMAKEKAREMRINAMDDSDDFTNSSSNSSTCDEGGQGPGSMPSI
DDDAASMGAGDMGETIGETTSRTTKSGAGADLPQDEAAHIQAPPGKWYYVSDSRVQEVSE
ETALKAQAYLLFYERIY
NT seq 3474 nt NT seq  +upstreamnt  +downstreamnt
atggttaagaaacgtcagacagatgtccatgagaatggcagctccacagatacgggtgac
gaggagaatcatcaccatcaagctggaggagctactaatctatcaactggaagtgctagc
gcttgccagcatattaaaaaatctgtagatgccaccaaattgagacgacaaataaagcta
accggtttactttacgaatgctcacaatgtcagaaaatcaaatctggaggagacgcaacc
ccagatcccagcgcctcatttgaatacgataataccctctggttgtgcctcaaatgtggc
actcaactgtgcggcagggcacgcaatcaacatgccctgcaacactatcagacaccacat
tcagattcgcattcattggccatgaatactcgaagctttgtcatttggtgctatgaatgc
gacaacgaggttagctccaactcccgcaaaaatttactcgagtgtgtcgagttggtaaaa
cgcttggcccaaaagccacccacaggattaacaaatgcatctgttgccccctctttacca
tctgagtcaccgccgccgccgaccacaatcagcaatattgagtcgaaaattaaaacggcc
ctgaaacaaattggtcccatggtgcccatgacggggggtcaacaacagcagcaaaaccag
aaggagcagcatcaagttgcaataccattaccaccgccgccaccagcagctgtgcctggc
atggccaaaagagttgatgtcgtcggcactggggcagcggcagcaggatctgctggagca
aagcgtggcgatgtcatcataaccaaagtgggttcagcagtggaaatcgatcggttgcca
actgtccgtggcctaaccaatttgggcaacacttgtttctttaatgcagtcatgcaatgt
ctggcccagacaccgtttctactctccgtgctaaaagagctgagcgaacctggcgaagaa
tttgtcctgcctggcggttcgtttagcttcaaggacaagggcaatattgagttgcctatg
attaggggtactctatcctcctggggtgggcttacagctgccttggccaatgccctggag
gaactgcaaggacgaggtggagtatttacacctagtaaactcttcgataaactttgcgcc
aaatgtccgcaatttaccggaggcgaccagcatgatgctcatgaattgttacgccaattg
ttggaaagtgtacgaaatgaagatttgaaacgctatcagcgagtaatccttcaaaatctt
ggctacaaggatcaggatattaacagtgtgtccgaagagatgcggcaaaaatgtaaaatc
tatggcaatcaagccggtgatcgtatactacggcctgagcaagtatttcgaggttttctc
gtgtccactttgacatgtcaggattgctttaatatctcatcgcgccatgaatactttctg
gatatgtcactgcctgtggccgtggagaaaccacagccgccccaaaggcgtaagcctagt
ccagagaacaatgccgtctccatgaccacgagcagtactaacacctctaaccttagtcca
aatcaaaatcagatgaatgctaaattgaatagtgccagcaacggcggcatttatcaagca
aatgatggtgatgatgccaagcaaccattctttttgcacactaaaactgaggatgaacag
ctgggccaacagcagggtcccacaaaatcacaattgaaaaaggaaaaggaacgagaacgc
aaggctaatcgagcggccaaacatcaacgccataaacaagcccagaaattggcattgaaa
gtgaatggcaatgcaaatggcgaaccagccacagaaccaacagctggtggcggagatgct
gcatctgctgctccatcggcaaccacaactaacgatgacgacgatgagttgccaagagag
gcggatactctctcttcaagtgttaccacatctgagcattcggatgccgatgtggaggat
aatctgcaagaggacactaccacaaccaatacagctacgacctcgaccagtacaacgacc
acagcacaagcaaaattctatacagacaagaatggtaatgctcagccggcggcgctggtt
ggtgagaagcgagatgatacccccgaccatatggataaagattccctggaggaagatgaa
aatgattcgggcatagcaactagtccagcgcccaccaccataaccaccagcaatgcgact
gctgccactaacaacggcaatgccacatcttcatcatctatgtccacatctgccacgtct
cgagctgatgatgaatccactgccgccagtctggtcacagccggactaagcgaaaagggt
gcttcattgatacgacagatttcgattggaaatggaactactaatggtatatccactgct
gccgatccaaatggcattcaattagctgccgctcaattggaacagttaaagctccgggaa
caggccggccaaagtggaggagcccttggtggcagtggcggcggcagcggcggcggcggt
gtccgatctaaacgtgtacgcacccaaagctactctgattggagtacaacaattgcaccg
cgatatcaatgcgaagatggcgaatgttcagttcaatcctgtcttaataatttcacagcc
gttgagctaatgaccggacagaataaagtcggctgtgaaagctgtaccaagcgtctcaat
ggacccgatcctaaggccaaatccgtcaatacgaatgcaaccaaacagctactgatttct
agtccgccagcggtactgatacttcatctgaaacgattccagctgggtccccgatgcatt
ttccgcaagctaacgcgagcggtcacctatcccatgctattggacgtggccgccttttgt
ggatcgaaggttaagaatttgcccaatatcgataggaagcagaagaagctattgtatgcc
ttatatggtgtggtggagcactctggtggcatgtatggcggtcattatacggcatttgtc
aaggtacgaccaaaactgatgcccgatgacaagcgatggaaatttttgccacacggaagc
aaagcagagctcgatcaggatgatgatcagctgaaaaaactagaggagctaatggccaag
gaaaaggcgcgagagatgcgaatcaatgccatggatgatagcgatgatttcaccaattcc
agcagtaattcatcaacctgcgatgaaggtggccaaggtccaggttcaatgccttcaatt
gacgacgatgctgcttcaatgggagctggcgatatgggcgagacgattggagagacgaca
tcgcggactacaaaatccggagcaggagcagatttgccacaagatgaagcagcccatata
caagcgccgcctggcaaatggtattatgtatccgattcacgtgtccaggaggtaagtgag
gagacggccctcaaggctcaggcttatctgctcttctatgaacgcatctactag

DBGET integrated database retrieval system