KEGG   Drosophila willistoni: Dwil_GK19855Help
Entry
Dwil_GK19855      CDS       T01067                                 

Definition
(RefSeq) GK19855 gene product from transcript GK19855-RA
  KO
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
dwi  Drosophila willistoni
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dwil_GK19855
Enzymes [BR:dwi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     Dwil_GK19855
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 628 aa AA seqDB search
HQHQQQQKQKQKQHQEQKQKQSPQLLPFMLLLVMLTLLTRPLSAFSNRLSDTKLHEIYLD
DKEIKLSWMVDWYKQEVLFHLQNAFNEQHRWFYLGFSKRGSLTDADICFFENQNGFFNVV
TDTYTSPDGLWVRKDYQQDCEVFKMDEFTLAFKRKFDTCDPLDLRLHEGTMYVVWARGET
ELSLEDHHQFAMPNISSPHEAGMKMMQLLRADKILIPETDLSTIDITLKQAPVPAIETTY
WCHVQRLDQIIKHRHHIVQFEPIIKNPHIVHHMEVFHCETDEHDEIPLYNGDCDQMPPKA
KVCSKVMVLWAMGASTFTYPPEAGLPVGGPGYNPYVRLEVHFNNVEMQAGLVDNSGFRIK
ISKTLRQYDAAVMELGLEYTDKMAIPPGQQAFPLSGYCVADCTRAGLPSNGIIIFGSQLH
THLRGLRVLTRHFRGEQELREVNRDDYYSHHFQEMRTLHYKPHVMPGDALVTTCYYNTSA
DKSAALGGFAISDEMCVNYIHYYPATKLEVCKSSVSEETLENYFIYMKRKEHQRGIHLNG
ARSANYRSIEWSQPRVDQLYTMYIQEPLSVQCNKSDGSRFEGHNWEGVAATPVQIKMPIH
RKLCPNYNPLWLKPLEKGECDLLGECIY
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
catcagcatcagcagcaacagaaacagaaacagaagcaacatcaagagcaaaaacaaaaa
cagtcaccgcagctgctgccattcatgttgctccttgtgatgttgacactgctgacgcga
ccattgagtgcattttcgaatcgtctatcagatacaaaacttcatgagatctatctggat
gataaggagataaaacttagctggatggtcgattggtataaacaggaggtacttttccat
ttgcaaaatgcattcaatgagcagcatcgttggttctatttgggtttctcgaaacgtggc
agcctcacggatgcggacatttgtttctttgagaatcagaatggtttcttcaatgtggta
actgacacatataccagtcccgatggtctttgggtgcgtaaggactatcagcaagattgc
gaggtctttaaaatggatgaatttactttggcatttaaacgcaaattcgatacatgtgat
ccacttgatttacgtttgcacgagggcaccatgtatgtggtttgggcacgtggtgaaacc
gaattatcgttggaggatcatcatcagtttgcgatgccaaatataagttcgccccatgaa
gccggcatgaaaatgatgcaattattgcgtgctgataaaatacttatacccgagacagat
ctgtctaccattgatatcactttgaaacaggcacccgttccagctattgagaccacctat
tggtgtcatgtgcaacggcttgaccagatcatcaagcatcgccatcacattgtgcaattc
gagcctataattaaaaatccgcacattgtccatcacatggaggtatttcactgtgaaacc
gatgagcacgacgaaattcctctttacaatggtgattgcgatcaaatgccacccaaggct
aaagtctgctccaaggtaatggtcttgtgggccatgggtgccagcacatttacatatccg
ccagaggctggccttccagtgggtggtccaggctacaatccctatgtaaggctcgaggtg
cactttaacaatgtagagatgcaggcaggccttgtggataattccggctttcgcatcaaa
atatcgaaaactttgcgtcaatatgatgcagctgttatggaattgggcctagagtatact
gataaaatggccataccacctggccaacaggcatttcctcttagcggttattgtgtggcc
gattgtacacgggcaggcttaccaagcaatggcataattatctttggctcccaattgcat
acgcatttgcgtggactccgtgtccttacgagacattttcgcggtgaacaggaacttcga
gaagtaaatcgtgatgattactattcgcatcatttccaagagatgcgtacattgcattat
aagccacatgtgatgccgggtgatgcattggttaccacttgctattacaatacctcggcc
gataagagtgcagctcttggcggattcgccatcagcgatgaaatgtgcgttaactatatc
cattattatccagcgacaaaacttgaggtatgcaaaagttctgtatcagaggagacgctc
gagaattacttcatctatatgaaacgcaaggagcatcagcgtggcatccatttgaatggg
gcacgttcagcaaattatcgtagcatcgaatggagccagccacgcgtcgatcaactgtac
acaatgtacatacaggagccgcttagtgtgcaatgcaacaaatcggatggttcacgcttc
gagggacacaattgggagggtgtcgccgcgacgcctgttcaaatcaaaatgcccatacat
cgtaagctctgccccaactataatccgttgtggctgaaaccgctggagaagggtgaatgc
gatttactgggcgagtgcatctactag

DBGET integrated database retrieval system