KEGG   Drosophila willistoni: Dwil_GK19855Help
Entry
Dwil_GK19855      CDS       T01067                                 

Definition
GK19855 gene product from transcript GK19855-RA
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
dwi  Drosophila willistoni
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:dwi00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 677 aa AA seqDB search
MALQLSSCRPRPRCRRLHQADIWKQDATETKIQHYQQHLQQQSHSQPKKHQHQQQQKQKQ
KQHQEQKQKQSPQLLPFMLLLVMLTLLTRPLSAFSNRLSDTKLHEIYLDDKEIKLSWMVD
WYKQEVLFHLQNAFNEQHRWFYLGFSKRGSLTDADICFFENQNGFFNVVTDTYTSPDGLW
VRKDYQQDCEVFKMDEFTLAFKRKFDTCDPLDLRLHEGTMYVVWARGETELSLEDHHQFA
MPNISSPHEAGMKMMQLLRADKILIPETDLSTIDITLKQAPVPAIETTYWCHVQRLDQII
KHRHHIVQFEPIIKNPHIVHHMEVFHCETDEHDEIPLYNGDCDQMPPKAKVCSKVMVLWA
MGASTFTYPPEAGLPVGGPGYNPYVRLEVHFNNVEMQAGLVDNSGFRIKISKTLRQYDAA
VMELGLEYTDKMAIPPGQQAFPLSGYCVADCTRAGLPSNGIIIFGSQLHTHLRGLRVLTR
HFRGEQELREVNRDDYYSHHFQEMRTLHYKPHVMPGDALVTTCYYNTSADKSAALGGFAI
SDEMCVNYIHYYPATKLEVCKSSVSEETLENYFIYMKRKEHQRGIHLNGARSANYRSIEW
SQPRVDQLYTMYIQEPLSVQCNKSDGSRFEGHNWEGVAATPVQIKMPIHRKLCPNYNPLW
LKPLEKGECDLLGECIY
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggcactgcaattgagcagttgtcgtcctcgtcctcgttgtcgtcgtcttcatcaagca
gacatttggaagcaggatgctactgaaaccaaaatacaacattatcaacaacatcttcag
caacaatcacattcacagccgaagaagcatcagcatcagcagcaacagaaacagaaacag
aagcaacatcaagagcaaaaacaaaaacagtcaccgcagctgctgccattcatgttgctc
cttgtgatgttgacactgctgacgcgaccattgagtgcattttcgaatcgtctatcagat
acaaaacttcatgagatctatctggatgataaggagataaaacttagctggatggtcgat
tggtataaacaggaggtacttttccatttgcaaaatgcattcaatgagcagcatcgttgg
ttctatttgggtttctcgaaacgtggcagcctcacggatgcggacatttgtttctttgag
aatcagaatggtttcttcaatgtggtaactgacacatataccagtcccgatggtctttgg
gtgcgtaaggactatcagcaagattgcgaggtctttaaaatggatgaatttactttggca
tttaaacgcaaattcgatacatgtgatccacttgatttacgtttgcacgagggcaccatg
tatgtggtttgggcacgtggtgaaaccgaattatcgttggaggatcatcatcagtttgcg
atgccaaatataagttcgccccatgaagccggcatgaaaatgatgcaattattgcgtgct
gataaaatacttatacccgagacagatctgtctaccattgatatcactttgaaacaggca
cccgttccagctattgagaccacctattggtgtcatgtgcaacggcttgaccagatcatc
aagcatcgccatcacattgtgcaattcgagcctataattaaaaatccgcacattgtccat
cacatggaggtatttcactgtgaaaccgatgagcacgacgaaattcctctttacaatggt
gattgcgatcaaatgccacccaaggctaaagtctgctccaaggtaatggtcttgtgggcc
atgggtgccagcacatttacatatccgccagaggctggccttccagtgggtggtccaggc
tacaatccctatgtaaggctcgaggtgcactttaacaatgtagagatgcaggcaggcctt
gtggataattccggctttcgcatcaaaatatcgaaaactttgcgtcaatatgatgcagct
gttatggaattgggcctagagtatactgataaaatggccataccacctggccaacaggca
tttcctcttagcggttattgtgtggccgattgtacacgggcaggcttaccaagcaatggc
ataattatctttggctcccaattgcatacgcatttgcgtggactccgtgtccttacgaga
cattttcgcggtgaacaggaacttcgagaagtaaatcgtgatgattactattcgcatcat
ttccaagagatgcgtacattgcattataagccacatgtgatgccgggtgatgcattggtt
accacttgctattacaatacctcggccgataagagtgcagctcttggcggattcgccatc
agcgatgaaatgtgcgttaactatatccattattatccagcgacaaaacttgaggtatgc
aaaagttctgtatcagaggagacgctcgagaattacttcatctatatgaaacgcaaggag
catcagcgtggcatccatttgaatggggcacgttcagcaaattatcgtagcatcgaatgg
agccagccacgcgtcgatcaactgtacacaatgtacatacaggagccgcttagtgtgcaa
tgcaacaaatcggatggttcacgcttcgagggacacaattgggagggtgtcgccgcgacg
cctgttcaaatcaaaatgcccatacatcgtaagctctgccccaactataatccgttgtgg
ctgaaaccgctggagaagggtgaatgcgatttactgggcgagtgcatctactag

DBGET integrated database retrieval system