KEGG   Drosophila willistoni: Dwil_GK19964Help
Entry
Dwil_GK19964      CDS       T01067                                 

Definition
GK19964 gene product from transcript GK19964-RA
Orthology
K17610  
calcineurin B homologous protein 1
Organism
dwi  Drosophila willistoni
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 251 aa AA seqDB search
MGIKASRQLNPDQVAAYQQQHNLSSEQIHQLYHRFRSLDRYERGYLTPTDLLRIPQLVEN
PLHRQIVDGFFPSRNTSERMDFGQFVAVCATFLVPGNGHLNVHRNVDRAKKLRLLSQMFD
THCGGDCILRSDFREVMSSFLYSHVPKGEELIPEMEAELDLLEDQAFGMGNEQMISYKQF
ERNLNTADVATRLSVCKWLHKEQGAGKPRQPGQAGQPGQPGQAGQPGQPGQPGQDDQANR
NKKNGQKFQQN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgggcattaaagccagccgtcaactgaatcctgaccaagtggccgcatatcaacagcag
cataatctatccagtgaacagatccatcagttatatcatcgctttcgctccctggatcgt
tatgagaggggatatctgacgccgaccgatctattgcgtataccccaattggtggagaat
cccttgcatcgtcaaatagttgacggcttctttccgtcacgtaataccagtgaacgtatg
gattttggccaatttgtggccgtctgtgccacattcctagtcccgggcaatggccatctg
aatgtccaccgcaatgtcgatagggccaagaagttgcgtctcctctcacagatgttcgat
acccattgcggcggcgattgtatcttacgttccgatttccgtgaggtaatgagttctttt
ctctacagtcacgttcctaaaggagaggaactcattcccgaaatggaggcagagttggat
ctattggaggaccaggcatttggtatgggcaacgaacaaatgatttcctataaacaattc
gaacgaaatctaaatacagccgatgtggctacaaggctatcggtttgcaagtggctgcac
aaggagcaaggagccggtaaaccgcgtcaaccaggtcaggcaggtcaaccgggtcaaccg
ggtcaggcaggtcaaccaggtcaaccgggtcaacctggtcaagacgatcaggcgaaccgc
aacaagaagaatggccaaaaatttcaacagaattga

DBGET integrated database retrieval system