KEGG   Drosophila willistoni: Dwil_GK20022Help
Entry
Dwil_GK20022      CDS       T01067                                 

Definition
GK20022 gene product from transcript GK20022-RA
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dwil_GK20022
Protein phosphatases and associated proteins [BR:dwi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dwil_GK20022
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1136 aa AA seqDB search
MPVKKNPEIKSEQSSPIVTRRSAQQAKIQTRAMVKSTSTSTSAAAATSTAAAAGATLSNR
SGEARKPSAALLEAKRRARNQLKAQSNMSNIVMHETVTDIFQNAVNAKGMLRGPTALIFD
ETMSQHCCLWDKLHWERPERFTRVLERCQELKLVDRCLRIKSRSATKEEILKLHTAEHYE
QLELTSGIRDDENMEELSSHFDSIYIHPSTFELSLLASGSTIELVDQLIMGKAQNGMAII
RPPGHHAMKAEFNGYCFFNNVALAAKHALDKHKLQRILIIDYDVHHGQGTQRFFYDDPRV
LYFSIHRFEYGSFWPNLHESDFHAIGTGAGQGYNFNVPLNATGMTNGDYLAIFQQLLMPV
ALEFQPELILVSAGYDAALGCPEGEMEVTPACYPHLLNPLLRLASCRVAVVLEGGYCLES
LAEGAALSLRSLLGDPCPPLVEPVQIPRQELTEALLNCIYAHRPYWRCLQLQKTYDTNSQ
LVGDHLTESSPNVDEHRVHRVWIGGPPAMDRYPTRDTAILLPPEVHARNKARLRILRAET
KLSAPTVRVCYAYEEEMLQHCNLHDVGHPEQPMRIKHIHQMHKEYELLTRMMPLMPRAAT
TDEVCLAHTRSHVNSIRRLLGRSPEELQELGAGFNSVYLHPRTFDCATLAAGSVLQAVDC
VLRGETRSGICNVRPPGHHAEPDQPHGFCIFNNVAIAAQYAIRDFGLQRVLIVDWDVHHG
NGTQHIFEANPKVLYISVHRYEHGSFFPKGPDGNYDVVGKQAGRGFNVNIPWNKKGMGDM
EYALAFQQLIMPIAYEFNPQLVLVSAGFDAAIGDPLGGCKVTPEGYGLFTHWLSALAGGK
IIVCLEGGYNVNSISYAMTMCTKSLLGDPMPTPQFNNGSGDARKPPTVAFQSCLETLQSC
LEVQRHHWKSVDFVNRRLPAGQGVVSENNNEDFLAATLQQLSLSNDQDAQGAAGGAQGDQ
RPSGSKPKVKVKTLTEFMAENKEALESEEMFAVYPRKNCPHLDQVLKELPPSINTNVACG
DCSSLTENWMCLSCQKIGCGRYINEHMEKHCLKHSHPLALSFSDLSVWCYKCSDYIDHPS
LYNILNLVHLSKFQEPMAWTYSCEKREDGCYSNQLDKDEDDGQNGSNFYIHLERDN
NT seq 3411 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttaaaaagaatcctgaaatcaaatccgaacagagctcaccgattgtaacgcga
cgcagtgcccaacaggccaagatccagacccgagccatggtgaaatccacatcgacttca
acatcggcagcagcagccacatcaacagccgctgccgccggagcaacactatcgaatcgg
agtggagaagctcgcaaaccgagtgcagcactgctagaagcaaaacgtcgtgctcgcaat
cagttgaaagcccaaagcaatatgtccaacatagtaatgcatgagactgtcaccgatata
tttcaaaatgctgtcaatgccaaaggcatgctacgtggccccacagccctgatctttgat
gaaacgatgagtcaacattgttgcctctgggataaattgcattgggagcgacccgaacgt
tttacacgtgtcttggaacgctgtcaggagctgaagctagtggatcgttgccttcgcatc
aaatcacgttcggccaccaaggaagagattcttaaacttcacacagccgagcattatgaa
caattggagctaacttctggcatacgcgacgatgagaatatggaagaattgagctcacat
tttgattccatctatatacatccgtccacttttgagctgtcacttttggcaagtggatcc
accattgagttggtggatcaattgatcatgggcaaagcgcagaatggcatggccattata
cgtccgcctggccatcatgccatgaaagcggaattcaatggctattgcttctttaataat
gtggccttggcggccaagcatgccttggataagcataaactgcaaaggattttaattatt
gactatgatgtccatcatggccagggaacccaacgattcttctacgatgatccaagggtg
ctctatttttctatacatcgtttcgagtatggaagcttttggccaaatttgcatgaatcg
gatttccatgcgattggaactggtgctgggcagggatataacttcaatgtacccctcaat
gcaacggggatgacaaatggtgattatttggccatattccagcagctcttgatgccagtt
gccttggaattccaaccggaattgattttagtatcggctggctatgatgccgccttgggt
tgtcccgaaggtgagatggaagtgacacccgcttgctatccgcatttgctcaatccgttg
ctacgcttggccagctgccgcgtggcagtggtcctggagggtggctattgcctggaatca
ttggccgaaggagcagcgcttagcttgcgtagtctgctcggcgatccgtgtcccccgctg
gtggagcccgtacaaattccacggcaagagctaaccgaagccctgctcaattgcatttat
gcacatcgtccgtattggcgttgtctgcagctacagaagacatatgacacaaactcccag
cttgttggtgatcatctgacagaatcgagccctaatgtggatgagcatcgagtgcatcgt
gtttggattggtgggccgccggccatggacagatatccgacaagagacactgccattctc
ctgccccccgaagtgcatgcccggaataaggcacggctgagaattttacgcgccgagacg
aaactatcggcacccactgtccgcgtttgttatgcctacgaggaggagatgctgcaacat
tgcaatctgcatgacgtgggccatccggagcaaccgatgcgcattaagcacattcatcag
atgcacaaggagtacgaattgttaaccagaatgatgcctttaatgcccagagcagccacc
acagatgaggtttgtctcgcccatacgcgatcccatgtgaattcgatacgtcgtctattg
ggacgcagccccgaggaactccaggaacttggagctggcttcaattcggtatatctgcat
ccgcgtacctttgattgtgccactttggcagccggttccgtgcttcaagctgtcgactgt
gtcctgcgcggtgagacgcgcagcggcatttgcaatgtacgtccgcctggacaccatgcc
gaaccggatcaaccgcatggcttttgtatattcaataatgtggccattgccgctcaatac
gccatacgagattttggtctgcagcgtgtgcttattgtcgattgggatgtccatcatggc
aatggtacccagcacatttttgaggcaaatccgaaggtcctgtacatatcagtgcatcgc
tatgagcatggcagcttcttccccaagggaccagatgggaattacgatgtggtgggcaag
caggctggtcgaggattcaatgttaatataccctggaataagaagggaatgggcgacatg
gagtatgctttggccttccaacaattgatcatgccaattgcgtatgagttcaatccccag
ttggtgttggtctctgctggattcgatgctgccattggtgatccattgggcggttgtaag
gttacgcccgagggctatggcctgttcacccactggctatcggcgttggctggcggcaag
attatcgtttgcctggaaggtggatacaatgtcaattccatatcatatgccatgacaatg
tgcacaaaatctctattgggtgatcccatgcccacgccacagttcaataatggctctggc
gatgccaggaaaccaccaacggtcgcctttcaaagttgcctggagacactgcaatcctgt
ttggaggtacaacgtcatcactggaagtccgtggactttgtcaatcgccgcctgccggct
ggtcaaggagtagttagcgaaaataataacgaggattttcttgctgctactttgcaacaa
ttaagtttatcaaatgaccaagatgcacagggcgcagctggcggtgcgcaaggagatcag
cggccaagcggcagcaaacccaaagtcaaggtaaaaacgctcaccgaatttatggccgag
aataaggaggcccttgaatccgaggagatgtttgccgtttatccgcgcaagaattgtcca
catttggatcaagtattaaaggaattgccgccatcaataaacacaaatgttgcgtgcggt
gattgctcttccctgacggagaactggatgtgcttgagttgccagaaaatcggttgtggt
cgttatattaacgagcatatggaaaaacactgcctgaaacattcacatccattggcattg
agcttcagcgatctatctgtttggtgttacaaatgttccgactacatcgatcatcccagt
ctgtataacattttgaatttggtgcatttgagtaaatttcaagagcccatggcctggacc
tatagctgtgagaaacgtgaagatggctgttactccaatcaattggataaggacgaggat
gatggccagaacggcagcaatttttatatacacttggaacgcgataactga

DBGET integrated database retrieval system