KEGG   Drosophila willistoni: Dwil_GK20066Help
Entry
Dwil_GK20066      CDS       T01067                                 

Definition
GK20066 gene product from transcript GK20066-RA
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
dwi  Drosophila willistoni
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    Dwil_GK20066
Enzymes [BR:dwi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     Dwil_GK20066
Glycosyltransferases [BR:dwi01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   Dwil_GK20066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 734 aa AA seqDB search
MTASMVKSQTKSEKVKTTDKANIKAPTTTITKAGEDENNSWRWWCLLVLVFTITFATRFY
KVTEPDHICWDETHFGKMGSWYINRTFFFDVHPPLGKMLIGLSGYLTGYNGTFPFEKPGD
KYNETRYQGMRYFCTTLGALIMPMGFDTVYDLTRSHEAALLSAAYLIFDVGILTLNQYIL
LDPILLFFMMGSVWGMVKISKTTASGQSYTLRWWLWLFITGTMLSCTISVKFVGLFVVLL
VGLHTATELWLILGDLRQPIVETVKQIACRALTLILWPILLYVIFFYIHLQVLNRSGNGD
GFYSSAFQSRLIGNSLYNASMPRDVAYGAVVTIKNHKTGGGYLHSHFHLYPKGAGARQQQ
ITTYTHKDDNNKWLIKPYNKQETPNGKLQLLRHGDLIRLEHAVTRRNLHSHSESAPMTKK
HLQVTGYGELGIGDVNDVWRVVTVGGKVNDSIHTVTSRLMFIHYLQNCALTSSGKQLPKW
GFEQQEVSCNPNIRDKMAQWNVEDNQHKLLPNVNFSMYAPGFIARFFESHAVMLQGNAGL
KPKEGEITSRPWQWPINYRGQFFSGNSYRIYLLGNPIIWWSNLIFLVLFMIVFLWNAIVE
QRRAGQTLLTSTDPRDSSTGSKEKSSVMSLQAAAWLFIGWILHYLPFWAMGRVLYFHHYF
PALIFNSMLTGVMFDYIIKNLPKYLQHILMGLMLSVIGYSFLVFSPLAYGMSGPLANEKN
STMYGLKWLSTWEF
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgacggctagtatggtaaaaagtcaaacaaagtcggaaaaagttaagacaactgacaaa
gccaatatcaaggcaccgacgacgacaataacaaaggcgggggaggatgagaacaactct
tggcgctggtggtgtcttttggttttagtatttacaattacatttgccacacgtttctac
aaggtaaccgaacccgatcacatttgttgggatgagacgcactttggcaaaatgggcagt
tggtatataaatcgtacattctttttcgatgtacatccaccattgggtaagatgcttatc
ggtctgtctggctatttaactggctataatggcacatttccctttgagaaacctggcgat
aaatacaatgagacacgttatcagggcatgcgatatttttgtaccactctgggtgctttg
ataatgcccatgggcttcgatactgtctacgatttgaccagatctcatgaggctgcttta
ttatcggctgcctatttgatttttgatgttggcattttgactttgaatcaatatatactt
ttggatcccattcttctattctttatgatgggttcggtttggggcatggtgaagatatca
aaaaccactgcatcgggccaatcttatacattgagatggtggctctggttgtttattacg
ggcaccatgctctcctgtacgattagtgtgaaatttgtgggtctctttgtggttctattg
gtgggtctgcatacagccacagagttatggctaattctgggtgatctacgtcaaccgatt
gtcgagactgtcaaacagattgcctgtcgtgctctcactttgattctgtggcccattctc
ctgtacgtgatattcttctacatacatctgcaagtgctgaatcgcagtggaaatggtgat
ggtttctacagttcggcatttcaatcgcgtttaattggcaattcgctgtataatgccagc
atgccccgagatgtggcctatggagcggtggttacaattaaaaatcacaaaactggcggc
ggttatttgcactcacattttcatctctatcccaagggagctggagccaggcagcaacag
attaccacctatacacacaaggatgataacaacaaatggctcattaagccatacaacaaa
caagagacaccaaacggaaagctccaattgttgcgtcatggcgatctaatacggctcgag
catgcggttacccgacgaaatcttcattctcacagcgaatcggcacccatgaccaagaag
catcttcaggtcaccggctatggtgagctgggcattggcgatgtcaacgatgtgtggcgt
gtggtcacggttggtggcaaagtcaacgattccatacacacggttacctcacgtttaatg
tttatacattatttacaaaactgtgctctaacctcgagtggcaaacaattgccaaaatgg
ggtttcgaacagcaggaagtgtcctgtaatccaaatatacgcgacaaaatggctcaatgg
aatgtcgaggataatcagcataaactattgcccaatgtgaactttagcatgtatgctccg
ggatttatagcacgtttctttgagtcccatgccgtaatgctgcaaggcaacgccggacta
aaacccaaagagggcgaaataaccagtcgaccctggcaatggcccatcaattataggggt
caattcttttcgggcaatagttatcgcatctatttattgggcaatcccattatatggtgg
agtaatctcatcttcttggtactctttatgatagtcttcctatggaatgccattgtagag
caacgtagagctggccaaactttgttaacatcaacagatccaagggattcttcaacagga
tcaaaggaaaagtcaagtgtcatgtcattacaggcagctgcttggctatttattggctgg
attctgcattatctaccattctgggcaatgggtagagttctttattttcatcattatttt
cctgccttgattttcaactccatgctgacgggtgttatgtttgattatattatcaaaaat
ctacccaaatatctgcaacatatattaatgggtctaatgctttcagtaattggctacagt
tttctagtattctcccctctggcctatggcatgagtggtccattggccaatgagaaaaat
tctaccatgtatggccttaaatggctttccacttgggaattttaa

DBGET integrated database retrieval system