KEGG   Drosophila willistoni: Dwil_GK20095Help
Entry
Dwil_GK20095      CDS       T01067                                 

Definition
GK20095 gene product from transcript GK20095-RA
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dwi  Drosophila willistoni
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:dwi03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 456 aa AA seqDB search
MSDFDLNVDSLIQRLLENFKKQKEAEEHAQKLLIAQQLAAAGGAAAAAAAAAVVSTSSIA
TPTSGGSSSSTSFAAGAGAGAGGSSSDPLDDLTEQQRRLLQQYSISPPSETMISADGDQI
TVHHPREEPKKSRLKLRDFFVAEFVRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLE
LEAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKY
PENFFLLRGNHECASINRIYGFYDECKRRYNVKLWKTFTDCFNCLPVAAIIDEKIFCCHG
GLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGVDVVSK
FLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVDDTLMCSFQ
ILKPSEKKAKYLYSGMNSSRPTTPQRCAPMPPNKKK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatttcgatttaaatgtggacagtctcatacagcggctgctggaaaatttcaaa
aaacaaaaagaggccgaagagcatgcccagaagctgctcattgctcaacaattggccgct
gctggtggggctgctgctgcagcggctgccgctgctgttgtttcaacatcatcgattgcc
acgcccacaagtggtggtagcagcagcagcacttcattcgctgcaggtgcaggagcaggt
gcaggtggttctagctcagatccattggacgatcttaccgagcagcagcgtcgtctattg
caacaatactcaatatcgccgcccagcgaaacaatgatctcagcggatggcgatcagata
acggtgcatcatccacgtgaggagccaaagaaatcgagattgaaattacgtgattttttc
gttgctgaatttgtgcgcagctgccgtaccggtaaacaggtgcaaatgacggaagccgag
gtccgcggattgtgtctcaagtcacgtgagatattcttgcaacagccgatactcttggaa
ttggaggcaccgctcatcatttgcggcgacattcatggccaatatacagatctattgaga
ttgtttgaatacggcggcttcccgccggctgccaattatctattccttggcgattatgtt
gatagaggcaaacaatcgttggagacaatctgtttgctgttggcctacaagatcaaatat
cctgaaaatttcttcttgctgcgcggcaatcatgagtgtgccagtattaatagaatttat
ggcttttacgatgaatgcaaacgtcgctataatgtaaaactctggaagacctttacagat
tgcttcaactgtttgccagttgctgcgattattgatgagaaaatcttctgttgtcatggc
ggacttagtcccgatctgcagggaatggagcaaattcgtcgcctaatgcgtcccacagat
gtgcccgatactggcctcctctgcgatctactctggagtgatcccgacaaggatgtacag
ggctggggtgaaaacgatcgtggtgttagtttcactttcggtgtggatgttgtatcgaaa
ttcttaaatcgtcacgagctcgacttgatttgtcgtgcacatcaggttgtggaagatggc
tatgagttctttgcccgtcgtcagctggtgacactattctcggctccaaactattgcggt
gaattcgataatgctggcggcatgatgaccgtggatgatacgctcatgtgctcattccag
atcttgaaaccatccgagaagaaagccaagtatttatatagcggcatgaactcatcgcga
cccacaacaccgcaacgctgtgcccccatgccgcccaataagaagaaataa

DBGET integrated database retrieval system