KEGG   Drosophila willistoni: Dwil_GK20334Help
Entry
Dwil_GK20334      CDS       T01067                                 

Definition
GK20334 gene product from transcript GK20334-RA
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dwil_GK20334
Peptidases [BR:dwi01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Dwil_GK20334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 324 aa AA seqDB search
MGEAAGNWCLIESDPGVFTELIREFGCDGAQVEEIWSLDGESFKNLEPIHGLIFLFKWVQ
EDEPAGKVVLDKDNIFFAKQVISNACATQAILSLLMNLEHEDIKLGETLTNFKDFCQCFD
PYTKGLTLSNASQIRTVHNSFARQTLFELDMKNPQKDEDVYHFVGYMPIGGRLYELDGLR
EGPIDLGEIKPDQNWVDVVRPIIEKRMQRYCNGEIHFNLMALISDRQRIYEQQIDKLLNP
SENAMDTEEDRQTEINSLRSYIQYEIEKKKRYKLENVRRKHNYLPFIVELLKMLGETGQL
MPIYEKAKQRALEREQKQCKKDSN
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaagcagctggcaattggtgtctcatagagagtgatccaggtgtttttactgaa
ctaatccgcgaatttggctgcgatggtgcccaggtagaggaaatctggagtctggatggt
gaatcgtttaagaatctggaacccattcatggtctgatattcctctttaaatgggttcag
gaagatgaacctgctggtaaagtggtcctggacaaggataatatcttctttgccaagcaa
gtgatcagcaatgcatgcgccacccaggcgatattaagtctgctaatgaatctcgagcac
gaggacattaaactgggtgaaacacttaccaatttcaaagacttttgtcaatgttttgat
ccttacacaaagggactaaccttaagtaatgcctcccaaatacgcacagtgcacaattcg
tttgcgaggcaaactctcttcgaattggacatgaagaatccccaaaaggatgaggatgtt
tatcattttgttggctatatgccaattggcggtcgactctatgagttagatggcctgagg
gagggtcccattgatttgggcgagatcaagccagatcagaattgggtagatgttgttcga
cccattattgagaaacggatgcaacggtactgcaatggcgaaatccatttcaatctaatg
gccctcatttcggatcggcagcgtatttatgaacagcaaattgataaacttcttaatccc
agtgaaaatgccatggataccgaggaagatcgtcagaccgaaataaatagcttgcgatcc
tatatacaatatgaaatcgagaaaaagaaacgatacaaactggaaaatgttagacgcaaa
cacaactatttgcccttcatagtcgaattgctgaaaatgctcggtgagactggacaactg
atgcccatttatgagaaggccaaacagcgggcgctggaacgcgaacagaagcaatgcaaa
aaggatagcaattaa

DBGET integrated database retrieval system