KEGG   Drosophila willistoni: Dwil_GK20397Help
Entry
Dwil_GK20397      CDS       T01067                                 

Definition
GK20397 gene product from transcript GK20397-RA
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dwi  Drosophila willistoni
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dwil_GK20397
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dwil_GK20397
   00620 Pyruvate metabolism
    Dwil_GK20397
   00640 Propanoate metabolism
    Dwil_GK20397
Enzymes [BR:dwi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Dwil_GK20397
Lipid biosynthesis proteins [BR:dwi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dwil_GK20397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 670 aa AA seqDB search
MPAEKSIYEPNPAISQKAYISSFDEYKKFYQESLDNPSDFWSRVAKQFHWETPADPDKFL
QYNFNISKGPISIKWMAGASTNICYNLLDRNVRNGLGDQIAYYWEGNHPDDYSRGLTYRK
LLEEVCRFANVLKDHGIKKGDRVSIYMPMILELPIAMLACARIGAVHSIVFAGFSPDSLA
ERLVDCKAKLLITADGAWRGEKPLYLKALCDTALEKAEELGHSVEKCIVVSHLKRVTPCQ
PDHVEEEIPWTDDRDYWWHEEMEDKEPACYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTA
GYLLYAATTFKIVFDYKPGDIYWCTADVGWITGHTYVVYGPLANGATSVIFEGTPFFPGN
DRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYY
RYIGKEQCSIVDTFWQTETGGHVITPLPGATPMKPGSASFPFFGVKPILLDECGIEIKGE
GEGYLVFSQPWPGMMRTLYNNHERFEDTYFSKFPGYYCTGDGARRDADGYLWITGRVDDM
LNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFITPNENEKFDQKLIADL
KKMVRERIGPFAMPDVIQNAPGLPKTRSGKIMRRVLRKIAVNDRNVGDTSTLADEQIVEQ
LFANRPIEAK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgccagcagaaaaatcaatatacgaaccaaatccagccattagtcaaaaggcttacata
tccagttttgatgaatataagaaattctatcaggaatcattggataatccttcggacttt
tggtcacgtgtggccaaacaattccattgggaaacaccagctgatcctgacaagtttttg
caatataatttcaatatttccaaaggacccatttcaattaaatggatggcaggagcctct
accaatatctgttataatctgttagatcgtaatgtacgtaatggattgggcgaccaaata
gcctattattgggagggcaaccaccccgatgattattcgcgcggtcttacctaccgcaaa
ctgttggaggaggtctgccgctttgccaatgtcttgaaagatcatggcattaagaagggt
gaccgcgtttcgatatacatgcccatgatattggagttgcccattgccatgttggcctgt
gcccgtattggagccgtacattccattgtctttgctggtttctcgcccgattcgctggcc
gagcgtctggtcgattgcaaggccaagctgttgatcaccgccgatggggcttggcggggc
gagaagcccctctatctgaaggcactctgcgatacggccctggagaaggccgaggagttg
ggccattcggtggagaaatgcattgtggtgtcgcatttgaagcgggttacaccctgccaa
ccggatcatgtcgaggaagagataccctggaccgatgatcgtgactattggtggcatgag
gaaatggaggacaaagagccagcctgctatcccgaatggatggacgccgaggatccatta
ttcatgctctatacgagtggttcgactggcaaacccaagggtgtcctccatacgacagcg
ggctatctactgtatgcggcgaccacattcaagattgtcttcgattacaagcctggggat
atctattggtgtacagccgatgtcggctggattaccgggcatacctatgtggtgtatggc
ccattggcaaatggtgccacttcggttattttcgagggcactccattctttcctggtaat
gatcgctactggagcgtcattgacaaatacaaggtcactcagttctatacggctccaacg
gccattcgggccttgatgaagtttggcgaaggacccgtcctgaagcataatttgagtggt
ctcaaagtccttggcagcgttggtgagcccatcaatccagaggcttggctctggtattat
cgctatattggaaaagagcagtgctccatagttgatacattttggcaaaccgaaaccggt
ggtcatgtcataactccactgcccggtgccacacccatgaaaccaggatcggcttcgttt
cccttctttggcgtgaaacccattctgcttgatgaatgcggcattgagattaagggcgaa
ggagagggctatttggttttctcgcagccctggcccggcatgatgcgcactctgtacaac
aatcatgaacgcttcgaggacacctatttctccaaattccccggctactattgcaccggt
gacggggcccgtcgcgatgcggatggctatttgtggatcactggacgtgtcgatgatatg
ttaaatgtttctggtcatctgatgtcaacagctgaggtggaatcggttctcaccgaacat
ccacgtgtcgccgaatcggctgtggtctcccgcccgcatccggttaaaggggaatgcctc
tattgcttcattacgcccaatgagaatgagaaattcgatcagaaactaatagcggacctc
aagaaaatggtacgtgaacgtattggaccatttgccatgccagatgttatacaaaatgct
cccggtttgcccaagacacgatctggtaaaataatgcgtcgtgtgttgcgtaaaatagcc
gtaaacgatcgcaatgtgggcgacacttcgaccctggcggatgagcaaattgtcgaacag
ctgtttgccaatcgtcccattgaggccaagtag

DBGET integrated database retrieval system