KEGG   Drosophila willistoni: Dwil_GK20397Help
Entry
Dwil_GK20397      CDS       T01067                                 

Definition
GK20397 gene product from transcript GK20397-RA
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dwi  Drosophila willistoni
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dwi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dwi00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dwi00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dwi00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 670 aa AA seqDB search
MPAEKSIYEPNPAISQKAYISSFDEYKKFYQESLDNPSDFWSRVAKQFHWETPADPDKFL
QYNFNISKGPISIKWMAGASTNICYNLLDRNVRNGLGDQIAYYWEGNHPDDYSRGLTYRK
LLEEVCRFANVLKDHGIKKGDRVSIYMPMILELPIAMLACARIGAVHSIVFAGFSPDSLA
ERLVDCKAKLLITADGAWRGEKPLYLKALCDTALEKAEELGHSVEKCIVVSHLKRVTPCQ
PDHVEEEIPWTDDRDYWWHEEMEDKEPACYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTA
GYLLYAATTFKIVFDYKPGDIYWCTADVGWITGHTYVVYGPLANGATSVIFEGTPFFPGN
DRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYY
RYIGKEQCSIVDTFWQTETGGHVITPLPGATPMKPGSASFPFFGVKPILLDECGIEIKGE
GEGYLVFSQPWPGMMRTLYNNHERFEDTYFSKFPGYYCTGDGARRDADGYLWITGRVDDM
LNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFITPNENEKFDQKLIADL
KKMVRERIGPFAMPDVIQNAPGLPKTRSGKIMRRVLRKIAVNDRNVGDTSTLADEQIVEQ
LFANRPIEAK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgccagcagaaaaatcaatatacgaaccaaatccagccattagtcaaaaggcttacata
tccagttttgatgaatataagaaattctatcaggaatcattggataatccttcggacttt
tggtcacgtgtggccaaacaattccattgggaaacaccagctgatcctgacaagtttttg
caatataatttcaatatttccaaaggacccatttcaattaaatggatggcaggagcctct
accaatatctgttataatctgttagatcgtaatgtacgtaatggattgggcgaccaaata
gcctattattgggagggcaaccaccccgatgattattcgcgcggtcttacctaccgcaaa
ctgttggaggaggtctgccgctttgccaatgtcttgaaagatcatggcattaagaagggt
gaccgcgtttcgatatacatgcccatgatattggagttgcccattgccatgttggcctgt
gcccgtattggagccgtacattccattgtctttgctggtttctcgcccgattcgctggcc
gagcgtctggtcgattgcaaggccaagctgttgatcaccgccgatggggcttggcggggc
gagaagcccctctatctgaaggcactctgcgatacggccctggagaaggccgaggagttg
ggccattcggtggagaaatgcattgtggtgtcgcatttgaagcgggttacaccctgccaa
ccggatcatgtcgaggaagagataccctggaccgatgatcgtgactattggtggcatgag
gaaatggaggacaaagagccagcctgctatcccgaatggatggacgccgaggatccatta
ttcatgctctatacgagtggttcgactggcaaacccaagggtgtcctccatacgacagcg
ggctatctactgtatgcggcgaccacattcaagattgtcttcgattacaagcctggggat
atctattggtgtacagccgatgtcggctggattaccgggcatacctatgtggtgtatggc
ccattggcaaatggtgccacttcggttattttcgagggcactccattctttcctggtaat
gatcgctactggagcgtcattgacaaatacaaggtcactcagttctatacggctccaacg
gccattcgggccttgatgaagtttggcgaaggacccgtcctgaagcataatttgagtggt
ctcaaagtccttggcagcgttggtgagcccatcaatccagaggcttggctctggtattat
cgctatattggaaaagagcagtgctccatagttgatacattttggcaaaccgaaaccggt
ggtcatgtcataactccactgcccggtgccacacccatgaaaccaggatcggcttcgttt
cccttctttggcgtgaaacccattctgcttgatgaatgcggcattgagattaagggcgaa
ggagagggctatttggttttctcgcagccctggcccggcatgatgcgcactctgtacaac
aatcatgaacgcttcgaggacacctatttctccaaattccccggctactattgcaccggt
gacggggcccgtcgcgatgcggatggctatttgtggatcactggacgtgtcgatgatatg
ttaaatgtttctggtcatctgatgtcaacagctgaggtggaatcggttctcaccgaacat
ccacgtgtcgccgaatcggctgtggtctcccgcccgcatccggttaaaggggaatgcctc
tattgcttcattacgcccaatgagaatgagaaattcgatcagaaactaatagcggacctc
aagaaaatggtacgtgaacgtattggaccatttgccatgccagatgttatacaaaatgct
cccggtttgcccaagacacgatctggtaaaataatgcgtcgtgtgttgcgtaaaatagcc
gtaaacgatcgcaatgtgggcgacacttcgaccctggcggatgagcaaattgtcgaacag
ctgtttgccaatcgtcccattgaggccaagtag

DBGET integrated database retrieval system