KEGG   Drosophila willistoni: Dwil_GK20438Help
Entry
Dwil_GK20438      CDS       T01067                                 

Definition
GK20438 gene product from transcript GK20438-RA
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
dwi  Drosophila willistoni
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:dwi03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:dwi03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 512 aa AA seqDB search
MADTKSGRYANSNATSGPSGSSSSTPPNISQLVQGPANLECKDFQEYLRTRQTPETLEKL
YNYPPICLAVYRDLPEIARQFIIRILFVDQPVPQAVVSSWGAQRCAKEQQEATSCLTSLN
VWRVTAIPGGLAAWELSPTFKKSVRQILLGGGKPWPMTNTLEKDSKPRDIAFLDSYAMSR
WRCVLHYMVGTGNRNGTDAEAISPDAVRILLHANLMKRDERDGITITRQGFQFLLLDTRA
QVWHFMMQYLDTCEERGISLPECLSMLFQLSFSTLGRDYSSEGMSHQMLAFLQHLREFGL
VFQRKRKEGRFYPTRLALNVTSKESADATTAIVTMSASEEEERMQDRGYIVVETNYRVYA
YTDSPLQVAVLGLFTELLYRFPNLVVGVLTRDSVRQALRGGITAEQIISYLEQYAHPNMK
LVESAINSKSCLPPTVVDQIKLWEMERNRFTYTEGVVYNQFLSTTDFVTLRDYAQSIQVL
VWQNEKTRTMVVQKNGHDDVKRYWKKYSKSAG
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggccgatactaaatccggtcgctatgccaattccaatgcaactagtggccctagtggc
agcagtagcagtactccccccaatatctcacaattggtccagggaccggctaatttggaa
tgcaaggactttcaggaatatctgcggacacgacagacgccggaaacgctggagaaactc
tacaattatccgcctatatgcctggctgtgtatcgagatttaccggaaatagcccgtcag
ttcattatacgcattctgtttgtagatcaacctgtaccgcaggcggtagtcagctcttgg
ggagcgcaaagatgtgccaaagaacagcaggaagccaccagttgtttaacatctctaaat
gtatggcgagtaacggccatacctggtggattggctgcttgggaattgtcacctacgttc
aagaagagcgttaggcaaatacttttaggcggcggcaagccctggccaatgacaaataca
ctggaaaaagactcaaaaccgcgtgacatcgccttcctggactcatatgcgatgtcacga
tggcgttgtgtacttcattacatggtaggcacgggcaatcgcaatggcacagatgcggaa
gccattagtccagatgctgtgcgaattcttctgcatgccaatctgatgaagcgagatgaa
cgcgatggcataacgataacacggcaaggattccagtttctattactggacacgagggca
caagtttggcatttcatgatgcaatacctggatacgtgtgaggaacgtggcatatcccta
cccgaatgcctctcgatgttattccaattgagtttctctacactgggcagggattacagc
tcggaaggaatgagccatcaaatgttggcatttctacaacatttacgggaattcggattg
gtttttcaaagaaaacgcaaagaaggacgcttctatcccacacgtttggctttgaatgtt
accagcaaagagtcagcggatgctaccacagccattgttactatgtcagcatcggaggaa
gaggaacgtatgcaggatcgtggctatatagtggtagagacaaattatcgtgtctatgcc
tatacggactcaccactgcaagtggctgttcttggactcttcaccgagctgttatatcgg
tttcccaatttggttgttggcgttctcacccgagattccgtgcgtcaggctttaagagga
ggcattacggctgaacaaattatctcctatctcgagcaatatgctcatccgaatatgaaa
cttgtagaatcagccatcaactcaaaatcctgcctaccacccacagttgtagatcaaatc
aagttgtgggaaatggaacgtaatcgtttcacctataccgagggtgtagtctataatcaa
tttctatcgacaactgatttcgtcactctacgggattatgctcaatccattcaagtattg
gtttggcaaaatgagaaaacacgtactatggtggtccagaagaatggacatgatgacgtt
aaacgctattggaagaagtattccaaaagcgctggctga

DBGET integrated database retrieval system