KEGG   Drosophila willistoni: Dwil_GK20490Help
Entry
Dwil_GK20490      CDS       T01067                                 

Definition
GK20490 gene product from transcript GK20490-RA
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
dwi  Drosophila willistoni
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dwil_GK20490
Enzymes [BR:dwi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dwil_GK20490
Exosome [BR:dwi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Dwil_GK20490
  Exosomal proteins of colorectal cancer cells
   Dwil_GK20490
  Exosomal proteins of bladder cancer cells
   Dwil_GK20490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 497 aa AA seqDB search
MKFLICALLFAASYVALASEVKVEEGVLVATVDNFKQVIADNEFVLVEFYAPWCGHCKAL
APEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYQVRGYPTLKFFRSGSPVEYSGGRQA
ADIIAWVTKKTGPPAKDLTSVAEAEQFLKDNEIAIIGFFKDTESEEAKTFTKAANALDSF
VFGVSSNADVLAKYEAKDNAVILFKPFDDKKSVFEGELTEENVKKFAQVQSLPLIVDFNH
ESAAKIFGGSIKSHLLFFVSKEAGHIETHVDPLKEIAKKYRDDILFVTISSDEEDHTRIF
EFFGMNKEEVPTIRLIKLEEDMAKYKPESNDLSVETIEAFLKKFLDGNLKQHLLSQDLPE
DWDKQPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDIVI
AKMDSTANELESIKISSFPTIKYFRKDDNKVIDYSLDRTLDDFVKFLDANGEVADAPEAA
EESEEETEEEAPKKDEL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcctaatctgtgctctactcttcgcagcgtcctacgtggcgcttgcctccgag
gtgaaagttgaagaaggtgtcctggtggcaacagtagacaacttcaaacaagtgattgcc
gacaacgaatttgtgctggttgaattctatgccccatggtgcggacactgcaaggctctg
gctcccgaatatgccaaggctgcccaacagctcgccgagaaggaatcccccattaagctg
gccaaggtcgatgctaccgttgagggtgaacttgccgagcagtatcaagtgcgtggctat
cccacattgaaattcttccgtagtggttcccccgtggagtacagtggtggacgtcaagct
gccgatattattgcttgggttaccaagaagactggtcccccggccaaggatctgacaagt
gtggccgaggctgagcagttcctgaaggataatgagattgccatcattggcttcttcaag
gataccgaatcggaggaggccaagaccttcaccaaggctgccaatgctctggattcgttc
gtgttcggtgtcagcagcaatgctgatgtgttggccaaatacgaggctaaggacaatgct
gtgatcttgttcaaacctttcgatgataagaaatcggtgttcgagggcgaacttaccgag
gagaatgtgaagaaatttgcccaagtgcaatcactgcctttgattgtggactttaaccat
gagtcggctgccaagatctttggtggttcaattaaatcgcatttgctgttcttcgtctcc
aaggaggctggacacattgagacccacgttgatcctttgaaggagattgccaagaaatac
cgcgatgatattctatttgtgaccatctcttccgatgaggaggaccacacacgcatcttt
gagttcttcggcatgaacaaggaggaagtgcccaccattcgtcttatcaaactggaagaa
gatatggccaagtacaagcctgaatccaacgatctgtctgtggagaccattgaggccttc
ctgaagaaattccttgatggcaacctgaaacagcatctgctatctcaggatttgcccgag
gattgggataagcaacccgtcaaggttctcgtctccagcaacttcgagagtgtcgctctg
gataagagcaaatcggtgctggttgaattctatgccccatggtgcggccattgcaagcag
ttggctcccatctatgaccaacttgccgagaagtacaaggataatgaagacattgtcatt
gccaaaatggactccactgccaacgagctggagagcatcaagatctcctcattcccaact
atcaaatacttccgcaaggatgacaacaaagtcatcgactacagtttggacaggactttg
gatgatttcgtcaagttcctcgatgccaatggtgaggttgccgatgcccctgaagctgcc
gaggagagcgaagaggagacggaggaagaggcgcccaagaaggacgagttgtaa

DBGET integrated database retrieval system