KEGG   Drosophila willistoni: Dwil_GK20508Help
Entry
Dwil_GK20508      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
dwi  Drosophila willistoni
Pathway
dwi00480  Glutathione metabolism
dwi00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Dwil_GK20508
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dwil_GK20508
Enzymes [BR:dwi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Dwil_GK20508
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin SCO1-SenC
Motif
Other DBs
NCBI-GeneID: 6645826
NCBI-ProteinID: XP_002068510
FlyBase: FBgn0222505
UniProt: B4N557
Position
Unknown
AA seq 232 aa AA seqDB search
MNLRQFQSITKQAFRCYTTRARVLAPAIELSQIQRQNLRYCALILPVGCAATASQFSTTA
ALDMSSGGDYKNATSIYEFTVKDTHGNDVSLDKYKGKVLLVVNIASKCGLTKNNYKKLTD
LKEKYGERGLVILNFPCNQFNSQMPEADGEAMVCHLRDSKADIGELFAKIDVNGDNADPL
YKYLKSKQTGTLGSGIKWNFTKFLINKEGIPVNRYAPTTDPMDISKDIEALL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaatctccgtcagtttcaaagcattacgaagcaggctttcaggtgctatacaactcgt
gcccgtgtcctagctccagccattgagttgagccaaattcagagacagaatcttcgctac
tgtgccctaatcttgccagttggctgtgcggcaactgcatcccagttctctacaacagct
gccctcgacatgtcgtccggtggtgattacaagaatgctacctcaatttatgagttcact
gtaaaggatactcatggcaatgatgtttctctggataaatataagggcaaagtcttgctt
gtggtgaacatcgcctccaaatgtggcttgaccaagaacaattacaagaaattgaccgat
cttaaggagaaatatggtgaacgtggcctggtcatattgaatttcccatgcaatcagttc
aactcacaaatgccagaggcagatggtgaggctatggtctgtcatttgagggattccaaa
gctgatattggcgagttatttgccaagattgatgtcaatggtgacaatgccgatcccctt
tacaagtatttgaagtcgaaacagactggaacccttggcagcggcattaaatggaatttc
accaagtttctgatcaataaggagggtattccagtcaaccgatatgcccctaccaccgat
cccatggacattagcaaggatattgaggccttattgtag

DBGET integrated database retrieval system