KEGG   Drosophila willistoni: Dwil_GK20508Help
Entry
Dwil_GK20508      CDS       T01067                                 

Definition
GK20508 gene product from transcript GK20508-RA
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dwi  Drosophila willistoni
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Dwil_GK20508
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dwil_GK20508
Enzymes [BR:dwi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Dwil_GK20508
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 254 aa AA seqDB search
MSGRSIIHFVFGALAIALGSYIYFTMQFQSITKQAFRCYTTRARVLAPAIELSQIQRQNL
RYCALILPVGCAATASQFSTTAALDMSSGGDYKNATSIYEFTVKDTHGNDVSLDKYKGKV
LLVVNIASKCGLTKNNYKKLTDLKEKYGERGLVILNFPCNQFNSQMPEADGEAMVCHLRD
SKADIGELFAKIDVNGDNADPLYKYLKSKQTGTLGSGIKWNFTKFLINKEGIPVNRYAPT
TDPMDISKDIEALL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtccggtcgttcgataattcattttgtgttcggagccttggccatagccttgggctcg
tacatctactttaccatgcaatttcaaagcattacgaagcaggctttcaggtgctataca
actcgtgcccgtgtcctagctccagccattgagttgagccaaattcagagacagaatctt
cgctactgtgccctaatcttgccagttggctgtgcggcaactgcatcccagttctctaca
acagctgccctcgacatgtcgtccggtggtgattacaagaatgctacctcaatttatgag
ttcactgtaaaggatactcatggcaatgatgtttctctggataaatataagggcaaagtc
ttgcttgtggtgaacatcgcctccaaatgtggcttgaccaagaacaattacaagaaattg
accgatcttaaggagaaatatggtgaacgtggcctggtcatattgaatttcccatgcaat
cagttcaactcacaaatgccagaggcagatggtgaggctatggtctgtcatttgagggat
tccaaagctgatattggcgagttatttgccaagattgatgtcaatggtgacaatgccgat
cccctttacaagtatttgaagtcgaaacagactggaacccttggcagcggcattaaatgg
aatttcaccaagtttctgatcaataaggagggtattccagtcaaccgatatgcccctacc
accgatcccatggacattagcaaggatattgaggccttattgtag

DBGET integrated database retrieval system