KEGG   Drosophila willistoni: Dwil_GK20588Help
Entry
Dwil_GK20588      CDS       T01067                                 

Definition
GK20588 gene product from transcript GK20588-RA
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
dwi  Drosophila willistoni
Pathway
FoxO signaling pathway
Wnt signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dwi04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dwi04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 520 aa AA seqDB search
MAAISGPKRHPLSNQHHFSHIIKSSTTTTTTSTTTNTTNTNTNSTINNTVNSTTTNNSIN
SNKTSGPGAGAASATACCPNYTAETPRSSSMSVSMSLVQGGAAGGAPQGASAILAAAAPY
YQPPAVPQDVQPDRPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKM
LCFFKHENVLSALDILQPPHLDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQI
LRGLKYLHSARILHRDIKPGNLLVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRA
PEILMGARHYSSAVDVWSVGCIFGELLGRRILFQAQNPVQQLELITELLGTPTMDDMRHA
CEGARTHMLRRAPKPPSFSVLYTLSSHATHEAVHLLCQMLVFDPDKRISVTDALAHPYLD
EGRLRYHSCMCKCCFTTSAGMRQYTADFEPSAGQPFDDLWERKLTSVQQVKEEMHKFIAE
QLQTGRVPLCINPQSAAFKSFASSTVAHPSELPPSPHQWE
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggcggccattagtggccccaagcggcatccattgagcaatcaacaccatttctcccac
atcatcaaatcaagcaccacaacaaccaccacctctaccaccaccaacaccaccaatacc
aataccaattcaaccattaacaatacagtcaatagcacaacaaccaacaacagcatcaat
tccaataaaacatcaggaccaggagcaggagcagcatctgcaacagcctgctgtccaaat
tataccgctgaaacgccgcgtagttcatcaatgagcgtttcgatgtcgttggtacagggt
ggtgctgccggtggtgcgccacagggcgctagcgcaatattagctgcagcggctccatat
tatcaaccgccagcagtaccccaggatgtacaaccggatcgtcccataggctatggtgca
ttcggtgttgtctgggctgtcacagatcctcgcgatggccgtcgtgtggccctcaaaaag
ctgccaaatgtgttccaatcgttggtctcatcgaaacgtgtttttcgtgaactgaaaatg
ctttgctttttcaagcatgaaaatgttctctcagctttggatattttacaaccaccacat
ttggatttctttcaagaaatctatgtgataacggaattgctgcaatcggatctacataaa
attatagtctcaccgcaacatttatctgccgatcatattaaagtctttctgtatcagata
ttgcgaggattgaaatatttacattcagcccggattcttcatcgtgacattaagcccggc
aatctgttggtcaattcgaattgtgtattaaagatatgcgatttcggtttggcacgcgtc
gaggagcccgatcaggccaagcacatgacccaggaggtggtcacacaatattacagggcc
cccgagattttaatgggtgcccgccattattcatcggctgtggacgtttggtcggtgggt
tgcattttcggtgaactcctgggacgtcgcattctcttccaggcccagaatccggtgcaa
caattggaactaatcaccgaattgctgggcacacccacaatggatgatatgcgtcatgcc
tgcgagggtgcccgcactcatatgttgcgtcgggcaccgaaacctccatccttctcggta
ctctacaccctgagctctcatgccacccatgaggctgtgcatttgttgtgccaaatgttg
gtatttgatccggataagagaatttcggtgacagatgccttggctcatccatatttggat
gagggtcgtttgcgttatcattcatgcatgtgcaaatgctgtttcactacctcggctgga
atgcgtcagtatacagcagattttgagccatcggctggtcagccctttgatgatctatgg
gaacgtaaattgacctcagtgcagcaggttaaggaggaaatgcacaaatttattgccgag
caattgcaaacgggtcgagtgccgctttgtattaatccacagagtgcggcatttaagagt
tttgccagctccactgtggcacatccatccgagctgccgccatcgccacatcaatgggaa
tga

DBGET integrated database retrieval system