KEGG   Drosophila willistoni: Dwil_GK20588Help
Entry
Dwil_GK20588      CDS       T01067                                 

Definition
(RefSeq) GK20588 gene product from transcript GK20588-RB
  KO
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
dwi  Drosophila willistoni
Pathway
FoxO signaling pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dwil_GK20588
   04068 FoxO signaling pathway
    Dwil_GK20588
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dwil_GK20588
Protein kinases [BR:dwi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dwil_GK20588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 434 aa AA seqDB search
MSVSMSLVQGGAAGGAPQGASAILAAAAPYYQPPAVPQDVQPDRPIGYGAFGVVWAVTDP
RDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQPPHLDFFQEIYVI
TELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLLVNSNCVL
KICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGELLGRR
ILFQAQNPVQQLELITELLGTPTMDDMRHACEGARTHMLRRAPKPPSFSVLYTLSSHATH
EAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQYTADFEP
SAGQPFDDLWERKLTSVQQVKEEMHKFIAEQLQTGRVPLCINPQSAAFKSFASSTVAHPS
ELPAIATSMGMTAK
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtttcgatgtcgttggtacagggtggtgctgccggtggtgcgccacagggcgct
agcgcaatattagctgcagcggctccatattatcaaccgccagcagtaccccaggatgta
caaccggatcgtcccataggctatggtgcattcggtgttgtctgggctgtcacagatcct
cgcgatggccgtcgtgtggccctcaaaaagctgccaaatgtgttccaatcgttggtctca
tcgaaacgtgtttttcgtgaactgaaaatgctttgctttttcaagcatgaaaatgttctc
tcagctttggatattttacaaccaccacatttggatttctttcaagaaatctatgtgata
acggaattgctgcaatcggatctacataaaattatagtctcaccgcaacatttatctgcc
gatcatattaaagtctttctgtatcagatattgcgaggattgaaatatttacattcagcc
cggattcttcatcgtgacattaagcccggcaatctgttggtcaattcgaattgtgtatta
aagatatgcgatttcggtttggcacgcgtcgaggagcccgatcaggccaagcacatgacc
caggaggtggtcacacaatattacagggcccccgagattttaatgggtgcccgccattat
tcatcggctgtggacgtttggtcggtgggttgcattttcggtgaactcctgggacgtcgc
attctcttccaggcccagaatccggtgcaacaattggaactaatcaccgaattgctgggc
acacccacaatggatgatatgcgtcatgcctgcgagggtgcccgcactcatatgttgcgt
cgggcaccgaaacctccatccttctcggtactctacaccctgagctctcatgccacccat
gaggctgtgcatttgttgtgccaaatgttggtatttgatccggataagagaatttcggtg
acagatgccttggctcatccatatttggatgagggtcgtttgcgttatcattcatgcatg
tgcaaatgctgtttcactacctcggctggaatgcgtcagtatacagcagattttgagcca
tcggctggtcagccctttgatgatctatgggaacgtaaattgacctcagtgcagcaggtt
aaggaggaaatgcacaaatttattgccgagcaattgcaaacgggtcgagtgccgctttgt
attaatccacagagtgcggcatttaagagttttgccagctccactgtggcacatccatcc
gagctgccggccatcgccacatcaatgggaatgacggcaaaatga

DBGET integrated database retrieval system