KEGG   Drosophila willistoni: Dwil_GK20594Help
Entry
Dwil_GK20594      CDS       T01067                                 

Definition
(RefSeq) GK20594 gene product from transcript GK20594-RB
  KO
K19584  
protein kinase X [EC:2.7.11.11]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dwil_GK20594
Protein kinases [BR:dwi01001]
 Serine/threonine protein kinases: AGC group
  PRKX family
   Dwil_GK20594
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 520 aa AA seqDB search
MSTATCARFCTPLTTKPSTVGGSTSTSSAASKLTAGNSGSVMTSSGYKKIPTNDINTEAT
FTFKLGGAGRTNGIGSATRGHCVASSESSDPLESDYSDEEEEEAEEQHANSTSTSTSNRS
NSSSSSSLQDVNDVDGDDDVDDDDDIGDGAAAPAASVGATGDDITNDSESIEDDDGNETD
DEEDEDDESSEEESSSVQTAKGVRKYHLDDYQIIKTVGTGTFGRVCLCRDRISEKYCAMK
ILAMTEVIRLKQIEHVKNERNILREIRHPFVISLEWSTKDDSNLYMIFDYVCGGELFTYL
RNAGKFTSQTSNFYAAEIVSALEYLHSLQIVYRDLKPENLLINRDGHLKITDFGFAKKLR
DRTWTLCGTPEYIAPEIIQSKGHNKAVDWWALGVLIYEMLVGYPPFYDEQPFGIYEKILS
GKIEWERHMDPIAKDLIKKLLVNDRTKRLGNMKNGADDVKRHRWFKHLNWNDVYNKKLKP
PILPDVHHDGDTKNFDDYPEKDWKPAKAVDQRDLQYFNDF
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtccacggcaacttgcgctcgattctgtacaccgttgacaacaaagccttcaacagtt
ggtggatccacatcaacttcatcagcagcatcaaaattgacggcaggaaattcaggaagc
gtcatgacgtcatcaggctataagaaaatacccacaaatgacatcaatacagaggcaaca
ttcacattcaaattgggcggagctggacgaacgaatggcattggttcagctacacgtgga
cactgtgtggcatcaagtgaatcatcagatcccctagaatcagattacagcgatgaggag
gaagaggaggcggaggaacaacatgccaacagtaccagcactagcaccagcaacaggagc
aacagtagcagcagcagttctctacaggatgtcaacgatgtcgacggcgatgatgacgtc
gacgatgatgatgatattggagatggtgctgctgctcctgctgccagcgttggtgctact
ggcgatgatattaccaatgattcagagagtattgaggacgacgatggcaatgagaccgac
gacgaggaggatgaagatgatgaatcgtccgaagaggaaagcagcagcgtccaaacagcc
aaaggagtacgcaaatatcatttggatgactatcagatcatcaaaactgtcggcactggc
acctttggacgcgtgtgtttatgtcgcgatcgcatttcggagaaatattgtgccatgaaa
attttggccatgaccgaagtcatacgtctaaagcaaattgagcatgttaagaatgagcgt
aatatattacgtgaaatacgacatccatttgtaatcagtctggaatggtccaccaaagat
gattcgaatctatacatgatctttgattatgtctgtggcggcgagctctttacatatttg
cgtaatgcaggcaaatttaccagtcaaacttccaacttctatgcggctgaaattgttagc
gccttggaatatttacactcgctacagattgtctatcgtgatcttaaacccgagaatctg
cttatcaatcgtgatggacatttgaagataacagattttggttttgccaaaaagttacgt
gatcgcacctggactttatgtggcacacctgagtatatagcacctgagataatacaatcc
aagggacacaataaggctgtggattggtgggccttgggtgttctaatttatgaaatgctt
gtgggttatccaccattctatgatgagcaaccatttggcatatatgaaaagatattgagc
ggcaaaattgaatgggaacgtcatatggatcccattgctaaagacttgatcaagaagcta
ttggtgaatgatagaaccaagcgactgggcaatatgaagaatggcgccgatgacgttaag
agacatcgctggtttaaacacttgaattggaatgatgtctacaataagaagcttaagcca
ccaatattgcccgatgtacatcatgatggtgatacaaaaaattttgatgattatcccgaa
aaggattggaaacccgccaaggcagtagaccaaagagatttgcagtacttcaatgatttt
taa

DBGET integrated database retrieval system