KEGG   Drosophila willistoni: Dwil_GK20778Help
Entry
Dwil_GK20778      CDS       T01067                                 

Definition
GK20778 gene product from transcript GK20778-RA
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
dwi  Drosophila willistoni
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 917 aa AA seqDB search
MNVSFSPPCPHSETNHKGVDKEQRLPPETSDSDNDLEREENMLKCHDELFSYSLNSLAKR
DEYLEEDATGSGTGLVGLQNLANTCYMNSALQALSNLNPMTHYFINCGDLVEHIADQSSS
RCKPVGLAKNYQRLMQDIWLNIDDPKEFIAPRGILYGIRSVHPMFRGYQQHDTQEFLRCF
MDQLHEELTEQIQQHQLKTEEKSDANEEDGDHVSATLHTPTASESEYDTCESSMSETSGE
VLMKTEYFMAPKIRSHKNSTSQSMPPAAAAAASPTVESSRSIISDVFDGKLLSSVQCLTC
DRISTREETFQDLSLPIPTRDFLNVLHQTHSLSVQSLNATDANEGWISWMWGLLRSWLYG
PSVTLYDCMASFFSADELKGDNMYSCEKCNKLRTGIKYSRVLNLPEVLCIHLKRFRHDLS
YSSKISSHVYFPLEGFDMHPYVDKNCQSQVYSYNLSSVICHHGTVGGGHYTCYARNSLNG
RWYEFDDQFVTEVLPEVVQNCQAYVLFYQKHNPQMKLVREEALSLSSMYPLCHSDIQFYV
TRKWLTRLATFSEPGPINNREILCPHGGILHSKADLISQIAVPISQPLWDYLFKIFGGGP
AVNILFQCEACKRVAECLARRQLYELNEFTKYNGLQSEHLDSSAIYAIAMPWLRSWQQFS
RGKTQKEPGPITNEGIAHPSDSTTSTISCVRTGADYAQLNARLWHFLHGIYGGGPEILLR
RALSDDDEADEIEIIDQDDETDEPELDTEVDVDEELHNTINHSDTESTVGRHFSPSTSPS
PVELPATSPLKTKRNRSNLKVSALRLNMRKRGRRNRNAFKQHAEMYGAEGNYHAHDPPMP
ADGSVANAVEQRIAFDHSITRPFQKDNFQVNGRREKISRDKSRSISATTNNNNKENVTLQ
KFVTLRESNGVNDETDI
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgagcttcagtccaccatgcccacactcagagactaaccacaagggagtggat
aaggaacaacggctaccacctgaaacttccgattcggacaacgatttggaacgcgaggag
aatatgctaaaatgtcacgatgagctctttagttattcgcttaactcgctggccaagcgg
gatgaatacctggaggaagatgccactggatcgggcactggactggtgggcttgcagaat
ttggccaacacttgttacatgaactcagctttgcaggctttgagcaatctaaatccaatg
acgcactatttcatcaattgcggcgatttggtagagcatatagccgatcagagttcgagt
cgttgtaagccagtgggtttggccaaaaattatcaaaggctaatgcaggatatttggtta
aatattgatgatcccaaagaatttattgcaccccggggtatactttatggcatacgttcg
gttcatcccatgttccgaggctatcagcagcatgatacccaggagtttttgcgttgcttt
atggatcaattgcatgaggagctaacggagcagattcaacaacatcaactcaaaacggag
gagaagtcggatgcaaatgaggaggatggtgaccacgtatcggccacccttcatacaccg
acagcctctgaaagcgagtatgatacttgtgagagcagcatgtctgaaacatcgggtgag
gtgcttatgaaaactgaatactttatggctcccaaaatacgaagtcataagaattccacc
agtcaatcgatgcccccagcagcagcagcagcagcgtcccccaccgtggagtcgtcccgt
tcgatcatcagtgatgttttcgatggcaaattattgtcttcggtgcaatgtttaacctgt
gatcgcatatctacgcgagaggaaacattccaggatctttccttgcccatcccgactagg
gatttccttaatgtcttgcatcagacacacagtcttagtgttcagagtttaaatgccacc
gatgccaatgagggttggatatcttggatgtggggtctgttacggtcatggctctatggg
ccatcggtgactttatacgattgcatggccagtttctttagtgccgatgagcttaaggga
gataatatgtatagttgcgagaaatgcaacaaattgcgaacgggcattaaatactcccgt
gtccttaatcttcctgaagttctgtgtattcacttgaaacgcttccgacacgatttatcg
tatagttcaaaaatatcgtctcatgtctatttccctctcgagggattcgatatgcatcct
tatgtcgataaaaattgccaaagtcaagtctattcgtataatctgtcatcggtgatttgt
caccatggtactgtgggtggtggccattatacttgctatgctcgtaattcacttaacggt
cgttggtacgaattcgatgatcaatttgtcaccgaggtgttacccgaggttgttcaaaat
tgccaggcttatgttttattctatcaaaagcataatccccaaatgaaactggtacgtgaa
gaggctcttagtttatcctccatgtatcccttatgccattccgatatacaattttatgtc
acacgaaagtggctaaccagattggccacattttccgaaccgggacccattaataatcga
gagatcctgtgccctcatggtggtatcctacattccaaagccgatttaattagtcagatt
gcagtgccaatttcccaaccgttgtgggattatctttttaagatatttggtggcggtccc
gctgtgaatatactattccagtgcgaggcttgcaaaagggtagccgagtgtttggccagg
cgccaactttatgaactgaatgagtttaccaaatataatggcttgcaaagtgaacatttg
gattcatcggccatttatgccattgccatgccttggttgcgttcgtggcagcaattttcg
cgtggcaaaacccaaaaggagccaggacctattacaaatgagggaattgcccatcccagc
gatagtaccacttccaccatcagttgtgtacgtacgggtgccgactatgcgcaattgaat
gccagactatggcatttcctgcatggtatctatggaggaggtcctgaaatattgctgcga
cgagcattatccgatgacgacgaagctgatgaaatcgagataattgatcaggatgatgaa
actgatgaacctgaactcgatacggaggtagatgtggacgaagaacttcataatactatc
aatcattcggatactgaaagtactgtgggtcgtcactttagtccaagcaccagtccgagt
cccgttgagctcccagccactagtccattaaaaacaaaacgcaacagatccaatctcaag
gtctcggcattacgtttaaatatgcgcaagcgtggaagacgtaatcgaaatgcctttaaa
cagcatgccgaaatgtatggagctgaaggaaactatcatgctcatgatccaccgatgccg
gctgatggttctgttgccaatgctgttgaacagcgtattgcatttgatcattctataact
agaccattccaaaaggacaatttccaagtcaatggacgccgtgagaaaatttcccgtgac
aaatctcgcagcattagcgccaccaccaacaataataacaaagaaaatgtcacattgcaa
aagttcgtcacattacgcgaatcgaatggggttaatgacgagactgatatttga

DBGET integrated database retrieval system