KEGG   Drosophila willistoni: Dwil_GK20798Help
Entry
Dwil_GK20798      CDS       T01067                                 

Definition
GK20798 gene product from transcript GK20798-RA
Orthology
K01619  
deoxyribose-phosphate aldolase [EC:4.1.2.4]
Organism
dwi  Drosophila willistoni
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dwil_GK20798
Enzymes [BR:dwi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.4  deoxyribose-phosphate aldolase
     Dwil_GK20798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 351 aa AA seqDB search
MEVKVLEVNKTLPFDPTLLTVNISLRQVEEIALSISQRCHVSGVNEIAWALRALMLTDLT
TLAGDDTAANVRRLCLRACYPFEPQFFDKYFERALLSDVHTAAVCVYPARVKDAYGALQQ
YDMLDKVAIAAVATGFPTGQYGLQTRLQEISHAILAGATEIDIVINRQLALVGDWEALYN
EVVLMRSACGERAHLKTILAIGELGTMENVYKAAMVCMLAGADFIKTSTGKEAVNATLPV
GLVMIFAIQEFKRRTCQIVGLKPAGGVRTVRDAIAWMTLVNETLGMRWLRPSRFRFGASG
LLDDIERVVRSGVAKLEAEEAAKLKSSAPELPKDSAAESFCKELRKKQEAE
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggaagttaaagtattggaagtcaacaaaacactgccatttgatcccacccttctaacg
gtcaatatatcattgcgtcaagttgaggaaatcgccttgagcatctcacagcgttgccat
gtgagtggggtcaatgagatcgcctgggcattgagggctctgatgttgacggacttaacg
acattggccggagatgatacggctgccaatgtacggcgattgtgtctacgtgcttgttat
ccatttgaaccgcaattctttgacaaatattttgaacgtgcccttctctccgatgtgcat
acggctgctgtgtgcgtgtatccagcccgggttaaagatgcttacggagctcttcagcaa
tatgatatgctcgataaggtggccattgcagcggtggccacaggatttcctacaggacaa
tacggtttgcagacccgtctgcaagagattagccatgccatattggccggagccaccgaa
attgatattgtaattaatcgtcaattggctttggtgggcgattgggaggcactgtacaat
gaggtggttctgatgcgcagcgcttgcggtgaaagagcacacttaaagactattctggcc
attggagaacttggaaccatggagaatgtatacaaagccgcaatggtttgcatgttggct
ggggcggatttcattaagacatccactggcaaggaggcagtcaatgccactctacccgtt
ggtctggttatgatctttgccatccaggagttcaagcgtcgtacatgtcaaatagtcggc
ctaaagccggccggaggtgtgcgtacagtgcgcgatgccatagcctggatgactctggtc
aatgaaactctgggcatgcgttggttacgtccatcacgttttcgctttggtgcctctggc
ctgctagacgatatcgaacgggtggtacgcagcggtgtggccaaactagaagccgaggag
gctgccaaattgaagagttccgcacctgaattgcccaaggatagtgctgcagaatccttt
tgcaaggagttgcgcaagaaacaagaagcagaataa

DBGET integrated database retrieval system