KEGG   Drosophila willistoni: Dwil_GK20798Help
Entry
Dwil_GK20798      CDS       T01067                                 

Definition
GK20798 gene product from transcript GK20798-RA
Orthology
K01619  
deoxyribose-phosphate aldolase [EC:4.1.2.4]
Organism
dwi  Drosophila willistoni
Pathway
Pentose phosphate pathway
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dwi00030]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 351 aa AA seqDB search
MEVKVLEVNKTLPFDPTLLTVNISLRQVEEIALSISQRCHVSGVNEIAWALRALMLTDLT
TLAGDDTAANVRRLCLRACYPFEPQFFDKYFERALLSDVHTAAVCVYPARVKDAYGALQQ
YDMLDKVAIAAVATGFPTGQYGLQTRLQEISHAILAGATEIDIVINRQLALVGDWEALYN
EVVLMRSACGERAHLKTILAIGELGTMENVYKAAMVCMLAGADFIKTSTGKEAVNATLPV
GLVMIFAIQEFKRRTCQIVGLKPAGGVRTVRDAIAWMTLVNETLGMRWLRPSRFRFGASG
LLDDIERVVRSGVAKLEAEEAAKLKSSAPELPKDSAAESFCKELRKKQEAE
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggaagttaaagtattggaagtcaacaaaacactgccatttgatcccacccttctaacg
gtcaatatatcattgcgtcaagttgaggaaatcgccttgagcatctcacagcgttgccat
gtgagtggggtcaatgagatcgcctgggcattgagggctctgatgttgacggacttaacg
acattggccggagatgatacggctgccaatgtacggcgattgtgtctacgtgcttgttat
ccatttgaaccgcaattctttgacaaatattttgaacgtgcccttctctccgatgtgcat
acggctgctgtgtgcgtgtatccagcccgggttaaagatgcttacggagctcttcagcaa
tatgatatgctcgataaggtggccattgcagcggtggccacaggatttcctacaggacaa
tacggtttgcagacccgtctgcaagagattagccatgccatattggccggagccaccgaa
attgatattgtaattaatcgtcaattggctttggtgggcgattgggaggcactgtacaat
gaggtggttctgatgcgcagcgcttgcggtgaaagagcacacttaaagactattctggcc
attggagaacttggaaccatggagaatgtatacaaagccgcaatggtttgcatgttggct
ggggcggatttcattaagacatccactggcaaggaggcagtcaatgccactctacccgtt
ggtctggttatgatctttgccatccaggagttcaagcgtcgtacatgtcaaatagtcggc
ctaaagccggccggaggtgtgcgtacagtgcgcgatgccatagcctggatgactctggtc
aatgaaactctgggcatgcgttggttacgtccatcacgttttcgctttggtgcctctggc
ctgctagacgatatcgaacgggtggtacgcagcggtgtggccaaactagaagccgaggag
gctgccaaattgaagagttccgcacctgaattgcccaaggatagtgctgcagaatccttt
tgcaaggagttgcgcaagaaacaagaagcagaataa

DBGET integrated database retrieval system