KEGG   Drosophila willistoni: Dwil_GK20927Help
Entry
Dwil_GK20927      CDS       T01067                                 

Definition
GK20927 gene product from transcript GK20927-RA
Orthology
K03259  
translation initiation factor 4E
Organism
dwi  Drosophila willistoni
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dwil_GK20927
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dwil_GK20927
Translation factors [BR:dwi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dwil_GK20927
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 266 aa AA seqDB search
MQSDFHRMKNFANPKSMFKSSAVPANSEQVAPGRPEPAPNAPATAVPPASKEESKPVSGE
SAPTQIPGNAGGGTNTDETVRTEHLFKHPLQNTWTLWYLENDRSKSWEDMQNEITSFDAV
EDFWSLYNHIKPPSEIKLGSDYSLFKKGIRPMWEDAANKQGGRWVITLNKSSKNDLDNLW
LDVLLCLIGETFDNSDQICGAVVNIRGKSNKISIWTANGNNEEAALEIGHKLRDALRLGR
QNSLQYQLHKDTMVKQGSNVKSIYTL
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcgattttcacagaatgaagaattttgccaatcccaagtccatgttcaaaagc
agtgctgttccggctaacagtgaacaggtggccccaggacgtccagaacctgccccaaat
gctccagccactgccgttccaccagcatctaaagaggaatcgaaacccgtttctggtgaa
tcagcccctacccaaattccaggcaacgcaggcggcggcaccaacaccgatgagactgta
agaacggaacatctgttcaagcatccacttcaaaacacatggactttgtggtatttggaa
aatgatcgcagtaaatcctgggaagacatgcaaaatgaaattaccagctttgatgccgtc
gaggatttctggagtctatataaccacattaaaccgccatcggagatcaaattgggcagt
gattactcgctctttaagaagggaatacgtcccatgtgggaagatgctgccaataagcaa
ggtggtcgctgggtaattacactcaataagagctccaaaaacgatttagataacttatgg
ctcgatgtgttgctttgcctgattggagagacatttgataactcggatcaaatttgtggc
gccgttgtcaacatacgcggtaaaagtaacaaaatttctatctggacggctaatggtaac
aatgaggaagctgctcttgagattgggcacaagctccgcgatgctctgcgtctgggacga
cagaattcattgcaatatcaactgcacaaggacaccatggtcaagcagggctcgaacgtt
aaatcgatctacactttataa

DBGET integrated database retrieval system