KEGG   Drosophila willistoni: Dwil_GK21084Help
Entry
Dwil_GK21084      CDS       T01067                                 

Definition
(RefSeq) GK21084 gene product from transcript GK21084-RA
Organism
dwi  Drosophila willistoni
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 141 aa AA seqDB search
MKAFIVLAALAAIAAPALGRTMDRCSLAREMSDLGVPRDQLDKWTCIAEHESSYRTGVVG
PENYNGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALLSDDITSSVRCAQKVLSQQG
WSAWSTWHYCNGWLPSIDDCF
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctttcatcgttttggctgctttggctgctattgccgccccagctctgggtcgc
accatggaccgttgctccttggcccgcgaaatgtccgatttgggtgtgccccgcgatcag
ttggacaaatggacttgcattgccgagcacgagagctcctaccgcactggcgtcgtcggc
cctgagaactacaatggctccaatgactatggtatcttccagatcaatgactactactgg
tgcgctcctcccagtggtcgcttctcctacaacgagtgcggcctgagctgcaatgccctg
ttgagcgatgacattaccagctcggttcgttgtgcccagaaggtccttagccagcaggga
tggtccgcctggtccacctggcactactgcaacggatggttgccatccattgatgattgc
ttctaa

DBGET integrated database retrieval system