KEGG   Drosophila willistoni: Dwil_GK21404Help
Entry
Dwil_GK21404      CDS       T01067                                 

Definition
GK21404 gene product from transcript GK21404-RA
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
dwi  Drosophila willistoni
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dwil_GK21404
Messenger RNA biogenesis [BR:dwi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     Dwil_GK21404
Translation factors [BR:dwi03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Dwil_GK21404
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 690 aa AA seqDB search
MAKKKSEEHSSADANDSDYQEEPNFDDPPNFVDNINDEDLLGDMLAQRPSEADGVESVVV
VDNIPKVEPSRLEKLKSVILKVFSHCGEIVNVVYPVDDEGTTKGYAFMEYRHASQAEDAV
KKLNNHRLDKNHTFAVNLFTDFQKYENIPEKWEPPTVQPFKIQNDLYNFINDPDAYDQYC
VAAETAPNCVQVGFWQNTLPEPNELETRERFTDTFVKWSPLGTYVVTFHKPGVAIWGGSN
FQKIQKFPHTGTQFVEFSPCENYLVTYGPTPTGQKIIIWDIRTGSEKRSFVADGMSVLSM
FRWSHDDKFVARMGENSIHIYETPSFYLLDLKSIKIPGIRGFSWSPTDNVIAYWVEEQNQ
IPARVTLMEIPKKREIRNKNLFHVADCKLHWQKSGDYLCVKVDRYSKLKKDKKELDVKFL
GMFYNFEIFHMREKEIPVDSVEIRELILAFAWEPIGNKFSIIHGELNSSNVSFYEVNKGV
KPSLVKRLEKKSCTHLFWSPRGQFIVMANLTMGTFEFVDTTNDYIISASPDHFRASEVEW
DPTGRYVVTGVSSWKVKEDTGFNMYTFQGRIIKRTILKNFVQFLWRPRPPTLLSEEKQKD
IKKNLKKYYPAFEQKDRLRLTRASKELLEKRSQLRETFMEYRNKRIAEWKDQKSRRVMLR
GHVDTDNLETEEVDEEIVEFLVKEEITLLE
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaagaagagtgaggagcattctagcgccgatgcgaatgacagtgactaccag
gaagagcctaatttcgatgatccgccaaattttgtggataatatcaacgatgaagatttg
ttgggcgatatgctggcccagcgcccatctgaggccgatggtgtggagagcgttgtagtt
gttgataacatccccaaagtagagccaagccgccttgagaaactgaagtcggtgatcctt
aaggtattctcgcactgcggcgaaattgtgaatgtcgtctatcccgtagacgatgaggga
actactaagggttacgctttcatggagtacaggcatgcctcccaggcagaggatgctgtc
aagaagctgaacaaccatcgcctggacaagaaccacacgtttgcggtgaatttgttcacg
gatttccagaagtacgagaatataccggaaaaatgggaaccaccaactgtgcagccgttc
aagattcagaatgatttgtacaactttatcaatgatccggatgcatacgaccagtactgt
gtggccgctgagactgcgccaaattgtgtccaggtaggattctggcaaaatactctgcca
gagcccaatgaactggagacacgagaacgcttcaccgacacctttgtcaagtggtcgcct
ttgggcacatatgtggtgacattccacaagccgggagtagctatttggggaggcagcaat
ttccagaaaatccagaaattcccccatactggtacccagtttgtagagttttcaccctgt
gagaattatttggtcacctatggacctacaccaactggtcagaaaattatcatttgggat
atacgcactggatccgagaaacgatctttcgtagccgatggcatgtcggtgttgtctatg
ttccgttggtcgcatgatgataagtttgtggcgcgtatgggcgagaattccatacacatc
tatgagacgccctcgttctatttgctcgatttgaagtcgattaagatacctggcattaga
ggattctcttggtcgcccacggacaatgtgatcgcttactgggtggaggagcagaaccaa
attccagcccgtgtaacactaatggagattcccaagaaacgcgaaatacgtaacaagaac
ctgttccatgttgctgattgcaaactgcattggcaaaagtctggcgactatctttgcgtc
aaagtggaccgctactccaagctcaagaaggataagaaggagttggacgtaaaattcctt
ggaatgttctacaactttgagattttccatatgcgggaaaaggagattccagtggattct
gttgagatccgtgagcttattttggcgtttgcctgggaacccattggcaacaagttctct
attatccatggcgagcttaattcctcaaatgtaagcttctatgaggtcaacaaaggcgtc
aaaccaagtttggtaaaacgattggaaaagaaatcctgcacgcatctcttctggtcacca
cgcggacaattcatagtcatggcgaatcttactatgggcacctttgaatttgtagacacc
accaacgattatataatcagtgcctcgcccgatcatttccgtgcctcggaggtggaatgg
gatcccactggacgttatgtcgttactggcgtctcatcgtggaaggttaaagaggacact
ggattcaacatgtacaccttccagggacgcattatcaagcgaacgatccttaagaacttt
gtgcagttcttgtggcgaccacgcccacccacccttttgtccgaagagaaacagaaggat
attaagaagaacttgaagaagtactacccagcgtttgaacaaaaggatcgcctacgtctc
acccgggcctccaaggaattgctggagaaacgctcccaactgcgcgaaacatttatggaa
tatcgcaacaagcgtattgcagagtggaaggatcagaagagtcgtcgcgtcatgctcaga
gggcatgtggacactgataacttggagactgaagaagtcgatgaagaaattgttgaattt
ttagtcaaggaagaaataactttgctcgagtag

DBGET integrated database retrieval system