KEGG   Drosophila willistoni: Dwil_GK21487Help
Entry
Dwil_GK21487      CDS       T01067                                 

Definition
GK21487 gene product from transcript GK21487-RA
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dwi  Drosophila willistoni
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:dwi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dwi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dwi00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dwi00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dwi00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dwi00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 788 aa AA seqDB search
MNSDINQRFLARGSQRDKGLAVFTSGGDSQGMNAAVRACVRMAIYLGCKVYFIREGYQGM
VDGGDCIQEASWASVSSIIHRGGTIIGSARCQDFRERAGRLKAANNLIQRGITNLVVIGG
DGSLTGANLFRQEWSSLLEELVKNSTITPEQQEKFNVLHIVGLVGSIDNDFCGTDMTIGT
DTALHRIIEAIDAISSTAYSHQRTFIMEVMGRHCGYLAISAAIATEADFMLIPEEPVPVD
WQDVLCQKLVQERKAGQRLNIVIVAEGAMDREGNPITAEDVKKVIDDRLHHDARVTVLGH
VQRGGNPSAFDRILACRMGAEATLALMEATKDSVPVVISLDGNQAVRVPLMECVERTQAV
AKAMKERRWADAVKLRGRSFERNLETYKMLTRLKPPKECFDADGKGIEGYRLAVMHIGAP
ACGMNAAVRSFVRNAIYRGDVVYGVSDGVEGLIAGNVRELGWSDVSGWVGQGGAFLGTKR
TLPEGKFKEIAARLKEFKIQGLLIIGGFESYHAAGQISDQRDNYPEFCIPIVVVPSTISN
NVPGTEFSLGCDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGAD
AAYIFEEKFSIKDLQQDVYHMASKMAEGVSRGLILRNEKASENYTTDFIYRLYSEEGKGL
FTCRMNILGHMQQGGSPTPFDRNMGTKMAAKCVDWLATQIKANIDANGVVNCKSPETATL
LGIVSRQYRFSPLVDLIAETNFDQRIPKKQWWLRLRPLLRILAKHDSAYEEEGMYITVEE
ECATDAVA
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgaattctgatattaatcaacgtttcctggcccggggttcgcagcgggacaagggattg
gccgtctttaccagcggaggtgattctcaaggcatgaatgccgccgtacgagcctgcgtg
cgtatggccatctatttgggatgcaaggtttatttcattcgcgagggctaccagggcatg
gttgatggcggtgattgcattcaggaggcatcctgggcatcagtgtcctcgatcattcat
cgcggtggcacaatcattggttcggcccgttgtcaagatttccgtgaacgtgccggccgc
ttgaaggcagccaataatctgattcaacgtggtattaccaatttggtggtcatcggtggt
gatggttccctcactggtgccaatttgttccgtcaggagtggtccagtctgctggaggag
ctcgtcaagaatagtaccattactcccgagcagcaggagaagttcaatgtgttgcatatt
gttggtttggttggctccattgacaacgatttctgtggcacggacatgaccattggcacg
gatacggctctgcatcgtatcatcgaggccattgatgccatttcgagtacggcgtattca
catcaacgtacattcattatggaggttatgggtcgtcattgtggctacttagccatttca
gctgctatagctactgaagcagattttatgttaattcccgaagaaccggtgccagttgac
tggcaggatgtactatgtcagaaacttgtacaggaacgtaaagctggtcaacgtttgaat
attgtgattgtggccgagggtgccatggatcgtgagggtaatcccattactgccgaggat
gtgaagaaggtcatcgatgaccgtctgcatcatgatgcccgtgtcactgtcttgggtcat
gtgcaacgtggtggcaatcccagcgcctttgatcgtattttggcctgtcgtatgggtgcc
gaagccactttggctttgatggaggccaccaaggattcggtgccagttgttatctcattg
gatggcaatcaggcggtgcgtgtccccttgatggagtgtgttgaacgcactcaggccgtg
gccaaggccatgaaagagcgccgctgggcggatgctgttaaattgcgtggccgttcattt
gaaaggaatctggagacatacaaaatgttgacacgcttgaagccacccaaggagtgcttc
gatgccgatggcaagggcattgaaggctataggctagccgtgatgcatattggtgcccca
gcttgtggcatgaatgcagctgtcaggagttttgtacgcaatgccatttatcgtggtgat
gttgtctatggtgttagcgatggtgtcgaaggtttgattgctggaaatgttagagaattg
ggatggtccgatgtgtccggttgggttggccagggtggcgcctttttgggcaccaaacgt
accctgcccgagggcaaattcaaggaaattgccgcacgccttaaggagttcaaaatccag
ggtcttctcattattggcggctttgagagttatcatgccgctggacagatatccgatcag
cgtgataattatcccgaattctgtattcccattgttgtggttccctcaaccatttcgaat
aatgtgcctggcactgaattctccttgggttgcgataccggcttgaacgagatcaccgag
atttgtgatcgtattcgtcaatcggcccagggtaccaagcgtcgtgtctttgtcattgag
acaatgggtggctattgcggctatttggccactttggctggcctggctggtggcgctgat
gctgcttacatttttgaagagaaattctccattaaggatctgcaacaggatgtctatcac
atggcctccaagatggctgagggtgtctcgcgtggtttgatcctgcgcaatgagaaggcc
agcgagaattatacaacagatttcatctatcgtctgtattcggaagagggcaaaggtctc
ttcacctgccgcatgaacattttgggccatatgcaacagggcggctcacccactcccttc
gatcgtaatatgggcactaagatggccgccaaatgcgtggactggttggccactcaaatc
aaggccaatatcgatgccaatggtgtggtcaattgcaagtcacccgaaacagccaccttg
ctgggcattgtatcccgccaatatcgttttagcccactggtggatctcattgccgagaca
aactttgatcaacgcatccccaaaaagcaatggtggttgcgtctccgccctcttcttaga
attctggccaagcacgattcggcctatgaggaggaaggcatgtacatcaccgtggaggag
gaatgcgccactgatgctgtagcctaa

DBGET integrated database retrieval system