KEGG   Drosophila willistoni: Dwil_GK21545Help
Entry
Dwil_GK21545      CDS       T01067                                 

Definition
GK21545 gene product from transcript GK21545-RA
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
dwi  Drosophila willistoni
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dwil_GK21545
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Dwil_GK21545
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 286 aa AA seqDB search
MWPSDLGVIYGRLNNLNTAHGFSSGAKPYIFQEVIDMGGEAISKTEYTGIGAVTEFRHSD
SIGKAFRGKDQLQYLVNWGTAWGFAASDRSLVFVDNHDNQRGHGAGGADVLTYKVPKQYK
MASAFMLAHPFGVPRVMSSFSFDDTDQGPPTTDGTNIASPGFNSDMSCSGGWVCEHRWRQ
IYNMVAFRNAADGAELQNWWDNGSNQISFSRGNKAFVAFNNDNYDLNSSLQTGLPAGTYC
DVISGVKNGSSCTGKSVTVGSDGRASISISSSADDGVLALHVNAKL
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgtggccctctgacttgggtgtcatctatggacgtctgaacaacttgaacactgctcat
ggtttcagctcgggtgccaagccttacatcttccaggaggtcatcgatatgggcggcgag
gctattagcaagactgagtacactggcattggtgccgttaccgagttccgtcactccgac
tccattggcaaggctttccgcggcaaggatcaattgcaatatctggttaactggggcacc
gcctggggcttcgctgcttccgatcgctctctggtctttgtggacaatcatgacaaccag
cgtggacatggagccggtggtgctgacgttcttacctacaaggtgcccaagcagtacaag
atggcctctgccttcatgttggcccatcccttcggcgttccccgtgtgatgtcctccttc
tccttcgacgataccgaccagggaccacccactactgatggaaccaacattgcctccccc
ggattcaacagcgacatgtcttgcagcggtggatgggtatgtgagcaccgttggcgccag
atctacaacatggttgccttccgcaacgccgccgatggcgctgaattgcagaattggtgg
gacaatggcagcaaccagatctccttcagccgtggcaacaaggctttcgttgccttcaac
aacgacaactatgatctgaacagctctctgcagaccggtcttcccgctggtacctactgc
gatgtcatctctggcgtgaagaacggctcctcttgcaccggcaagtcggtcaccgttggc
tctgatggtcgtgcctccatctctatcagcagctctgctgacgatggtgtcctggctctt
catgtcaacgcgaagttgtaa

DBGET integrated database retrieval system