KEGG   Drosophila willistoni: Dwil_GK21564Help
Entry
Dwil_GK21564      CDS       T01067                                 

Definition
(RefSeq) GK21564 gene product from transcript GK21564-RB
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14]
Organism
dwi  Drosophila willistoni
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dwil_GK21564
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dwil_GK21564
   00640 Propanoate metabolism
    Dwil_GK21564
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Dwil_GK21564
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    Dwil_GK21564
Enzymes [BR:dwi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Dwil_GK21564
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Dwil_GK21564
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 2439 aa AA seqDB search
MEKNSSSVIVATATTPTTSGATTTTGGPATSAGTGGSIKSNDKRYNKTTCIKKVKFSSES
LKAEVDEICEQLKDNALIDLSNDNLRVNYRPHHQQNSINHHHHNNNNISNNKYNMSTTEA
ENDVATGTPTDAERPSFLVGDEIDEKAAEAGEAVDEFPQKLQSDIRQNGDISERRKRLRP
SMSRGTGLGQDRHQDRDFHIATTEEFVKRFGGTRVINRVLIANNGIAAVKCMRSIRRWSY
EMFKNERAVRFVVMVTPEDLKANAEYIKMADHYVPVPGGSNNNNYANVELIVDIALRTQV
QAVWAGWGHASENPKLPELLHKEGLVFLGPPERAMWALGDKVASSIVAQTAEIPTLPWSG
SELKAQYSGKKIKISSELFARGCVTNAEQGLAAVNKIGFPVMIKASEGGGGKGIRRVDTA
EEFPALFRQVQAEVPGSPIFVMKLASGARHLEVQLLADQYGNAISLFGRDCSIQRRHQKI
IEEAPAIVAQPEVFEDMEKAAVRLAKMVGYVSAGTVEYLYDPEGKYFFLELNPRLQVEHP
CTEMVADVNLPACQLQIGMGIPLYRLKDIRLLYGESPWGSSIIDFENPPNKPRPSGHVIA
ARITSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVAASGGLHEFADSQFGHCFSWGENR
QQARENLVIALKELSIRGDFRTTVEYLITLLETNRFLDNSIDTAWLDALIAERVQSEKPD
ILLGVMCGSLHIADREITESFSSFQTSLEKGQIQAANTLTNVVDVELIHDGIRYKVQAAK
SGANSYFLLMNSSFKEIEVHRLSDGGLLISFEGASYTTYMKEEVDRYRIVIGNQTCVFDK
ENDPSLLRSPSAGKLINLIVEEGAHVSKGQAYAEIEVMKMVMTLTSLEAGTVTFVRRPGA
VLEAGSLLGHLELDDPSLVTKAQPCKSQFPTPENAPVPEKLNRIHNTYKSILENTLAGYC
LPEPFNAQRLRDIIEKFMQSLRDPSLPLLELQEVIASISGRIPISVEKKIRKLMTLYERN
ITSVLAQFPSQQIASVIDSHAATLQKRADRDVFFLTTQSIVQLVQRYRNGIRGRMKAAVH
ELLRQYYDVESQFQHGHYDKCVGLVREHNKDDMQTVVNTIFSHSQVAKKNLLVTLLIDHL
WANEPGLTDELANTLSELTSLNRAEHSRVALRSRQVLIAAHQPAYELRHNQMESIFLSAV
DMYGHDFHPENLQRLILSETSIFDILHDFFYHSNRAVCNAALEVYVRRAYTSYELTCLQH
LELSGGLPLVHFQFLLPTAHPNRLFSRMSSPEGLDQAAAESLGSSFVRTGAIAAFDSFEH
FEMYSDEILDLLEDFVSPALVSAKVLEAVEAVDSISDSRHSTSINVSLSDPVTRANAAEE
AKSTEPIHIVSVAVRETGEMDDLQMAQIFGNYCKEHNEELFQRRIRRITFAALKKRQFPK
FFTYRARDKFEEDRIYRHLEPASAFHLELNRMKTYDLEALPTANQKMHLYLGRAKVSKGQ
EVTDYRFFIRSIIRHSDLITKEASFEYLQNEGERVLLEAMDELEVAFSHPHAKRTDCNHI
FLNFVPTVIMDPAKIEESVTKMIMRYGPRLWKLRVLQAELKMVIRQSPQSPTQAVRLCIA
NDSGYFLDISMYTEQTEPETGIIKFKAYGEKQGSLHGHPISTPYMTKDFLQQKRFQAQSN
GTTYVYDVPDMFRQMSERHWREFSKARPTVDIRIPDKILLECQELVLEGDNLVEMQRLPG
ENNCGMVAWRIVLATPEYPNGREIIVIANDLTYLIGSFGIKEDILFAKASQLARERKVPR
IYISVNSGARIGLAEEVKSMFRIAWEDPEEPDKGFKYLYLSTEDYAKVANLNSVRAILIE
DEGEQRYKITDIIGKDDGLGVENLRYAGLIAGETSQAYEEIVTIAMVTCRTIGIGSYVVR
LGQRVIQIDNSHIILTGYAALNKLLGRKVYASNNQLGGVQIMFNNGVTHKTEAIDLDGVY
TILDWLSYIPAHIGCELPIVLPCDRVDRPVDFMPTKSPYDPRWMLAGRVNPVNANEWENG
FFDRDSWSEIMAPWAKTVVTGRARLGGVPVGVIAVETRTVEVEMPADPANLDSEAKTLQQ
AGQVWYPDSSYKTAQAIKDFGREELPLIVFANWRGFSGGMKDMYEQIVKFGAYIVDGLRE
YKKPVLIYLPPNAELRGGAWAVLDSLINPRYMETYADPEARGGVLEPEGIVEIKYKEKDL
VKTIHRLDATTIALKRELDEATAAGDKVKVAQLDEKIKARISILMHVYHTVAVHFADLHD
TPERMLEKECISEIVPWRDSRRWLYWRLRRLLLEDAHIKKILRAQDNLSVGQAKQMLRRW
LVEEKGATEAYLWDKNEQMVAWYEEQTKNQESIVTRNVNSVRRDAIISTISKMLEDCPDV
ALDAVVGLCQGLTPVNRGVVVRTLAQMQLNEESSSNTQG
NT seq 7320 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaaacagctccagcgtcattgtagcgacagcaacaaccccaacaacctctgga
gcaacaacaaccacaggaggaccagcaacatctgcaggaacaggaggatcaatcaaatcc
aacgacaaacgttataacaagacgacctgcattaagaaagtcaaattctccagcgaaagc
ttaaaagccgaggttgatgaaatttgtgagcagttaaaggataacgccttgattgatcta
agcaacgataatttaagagtaaattatcgtccacatcatcagcaaaacagcatcaatcac
caccaccacaacaacaacaatatcagcaataataagtacaacatgagcacaacagaggcc
gaaaatgatgtggcaacaggcactcccacagatgcagagaggcctagttttttggtgggc
gatgaaatcgatgagaaggcagccgaagctggcgaagcagttgatgagttcccccaaaag
ctgcagagcgatatacgccagaatggcgacatatccgaacgacgcaagcgactgaggccc
agtatgtcacgcggtaccgggttgggacaggatcgtcatcaggatcgtgatttccatatt
gccaccacggaggagtttgtaaaacgtttcggtggcactcgtgtcattaatcgtgtcctt
attgccaacaatggaattgcggcagtgaaatgtatgcgttccattcgtcgttggtcctac
gagatgttcaaaaatgaacgtgccgtacgttttgtggttatggtcactccggaggatttg
aaagccaatgccgagtacatcaaaatggccgatcattatgttcccgtgcccggcggttcc
aataataacaattatgccaatgttgagctcattgtggatattgcacttcgcactcaagtt
caggccgtttgggctggttggggtcatgcctcagagaatccgaaattacctgaactgctg
cataaggagggtctggtctttttgggaccaccagaacgtgccatgtgggctttgggtgac
aaggtggcatcctcgattgttgctcaaacagctgagatacccaccctgccatggtccggt
tcggagctgaaggcacagtatagcggcaagaaaattaagatttctagcgaattgtttgcc
cgcggttgtgttaccaatgcggagcagggtctggctgcagtaaataagattggtttccct
gtgatgatcaaggcatcagaaggtggtggcggcaagggtattcgtcgtgtggataccgct
gaagagttccccgctctcttccgtcaagtgcaagccgaggtacccggttcacctattttc
gtaatgaaattggccagcggtgcccgtcacttggaggtccagctgttggctgatcagtat
ggcaatgccattagtttgtttggtcgtgactgttccatacagcgacgccatcagaagatc
attgaggaagctccggctattgtggctcagcccgaagttttcgaggacatggaaaaggct
gctgtgcgtttggccaaaatggttggctatgtcagtgccggaactgtggagtatctgtac
gatccagagggtaaatatttcttcctcgagctaaatccacgtcttcaagtggagcatcct
tgtacggaaatggttgccgatgtcaatttgccagcctgtcagctacaaattggaatgggt
attcccctatatcgattaaaagacattcgtctactgtacggagagtctccatggggctcg
tcaataattgactttgagaatcctccaaataagccacgtccatctggacatgtgattgct
gcccgcataacctccgagaatcccgatgagggtttcaaacccagttcaggaactgtgcaa
gagttgaatttccggtctagcaagaatgtgtggggttacttcagtgtggccgcatccgga
ggattgcatgagtttgccgactcgcagtttggccattgtttctcatggggtgaaaatcgt
cagcaggctcgtgagaatcttgtgattgccctgaaagagctgtccattcgtggtgatttc
cgaactactgttgagtacctgatcacattgctggagacgaatagatttttggacaatagc
atagacacagcctggttggatgctttgattgctgaacgtgtccagtcggagaaaccggac
atcttgctaggcgtcatgtgtggttcgcttcatatcgctgaccgtgagatcacggaatct
ttttcaagcttccaaacctcgctggagaagggccagatacaggcggccaacactctgacc
aatgtggtcgatgtggaactcattcatgatggcatccggtataaggtgcaggcagccaag
agcggagcaaactcctatttcctgctgatgaatagttcatttaaggagattgaagtgcat
aggctttcggacggtggtttgcttatctcattcgaaggcgcttcctataccacctacatg
aaggaggaggtcgatcgctatcgtatcgtcattggcaatcagacttgtgtctttgataag
gagaatgatccttctctgctgcgaagtccatcggctggtaagctgatcaatctgattgta
gaagaaggtgctcatgtgagtaagggtcaagcgtatgctgagatagaggtgatgaaaatg
gttatgaccctcacttccctcgaagcgggcacagtgacatttgtgcgacggccgggtgcc
gttttggaggcgggatctctgttgggtcaccttgaactggacgatccttcattggtaacg
aaagcgcagccttgcaagagccaattccccacacctgagaatgcaccagtgccagagaag
ctgaatcgcatccataacacctacaagagcatcttggagaacactttggcgggctattgt
ctgcccgagccatttaatgcccagcgtctgcgtgacatcattgagaaattcatgcaaagc
ttgagagatccctcattgccgctgcttgaattgcaggaggtgattgcctccatatcggga
cgtattcccatctcggtggagaaaaagattcgcaagctaatgaccttgtatgagcgcaat
attaccagtgttctggcccagttcccatcccagcagatagccagtgtcatcgatagccat
gctgccaccctgcagaagcgagccgatcgcgatgtcttcttcctgaccacccagagcatc
gtgcagctggtgcagcgctataggaatggcatccgtggtcgcatgaaggctgctgtccat
gagcttttgcgtcaatactacgatgttgagtcccagttccagcatggtcactacgataag
tgtgtgggcctggtgcgggaacacaacaaggatgacatgcaaactgtggtgaacaccata
ttctcccactctcaggtggcaaagaagaatctgctggtcaccctgctcatcgatcatttg
tgggccaatgaacccggtctcacggatgagttggccaacactttgagtgaattgacctct
ctgaatcgtgcggagcattcgcgagtggcattgagatcacgacaggttttgattgctgcc
caccagccagcctacgagttgcgacataatcaaatggaatccatctttctgtcagccgtt
gatatgtacggccatgatttccatcccgagaatttgcagcgtttaattctgtcggagacc
tcgatctttgatatactccacgatttcttctatcactccaatcgggcggtgtgcaacgct
gcccttgaggtttacgtcagaagagcctacacatcgtacgaattaacctgtctccagcat
ttggaactctctggaggcttgcctctggtgcacttccaattcttgttgcccactgcccat
ccgaatcgccttttctcacgcatgtcctcgcccgagggtctagatcaggcggctgccgaa
agtttgggcagttcctttgtacggaccggcgccatagcagcgtttgattcattcgagcac
tttgaaatgtattccgatgaaattctggacttgctcgaggacttcgtctcacctgcattg
gttagtgctaaggttctggaggccgtggaggctgtggattccatttcggacagtcgtcat
agtacatcgattaatgtatcgctatcggatcctgtgacccgggcaaatgccgcggaggag
gccaagtccaccgaacccatacacattgtcagtgttgcggtgagggaaaccggcgaaatg
gatgatctgcagatggcccaaatattcggaaactactgcaaagagcacaacgaagagctg
ttccaacggcgcatcaggagaattacttttgctgccctcaagaaacgtcagttccccaag
ttctttacctatcgtgcacgcgataaattcgaggaggatcgcatataccgtcatttggag
cccgcttctgctttccatttggagctgaatcgtatgaagacctacgatttggaagctctg
ccaacggcaaaccaaaagatgcatttgtacttgggcagagccaaggtgtccaagggacaa
gaggtcacagattatcggttcttcattcgttcaatcattcgacactcggatctcatcacc
aaggaggcatcgttcgagtatctacaaaacgaaggagaacgcgttctcctcgaggctatg
gatgaactggaggtggccttctcccatccccatgcaaaacgcaccgattgcaatcacatt
ttcctcaactttgtgcccactgtcattatggatcccgcaaaaatagaggaatcggtgact
aaaatgattatgcggtatggcccacgtctatggaaacttcgagtgctgcaggctgaactg
aaaatggttatccgtcagtcgccgcaatcacccactcaggcagtgcgtctttgcatagcc
aatgattcgggttacttcctcgacatctccatgtacacagagcaaaccgaaccggagact
ggaattattaagttcaaggcttatggcgagaagcagggatctctacatggtcatcccatt
tccacaccctacatgaccaaagactttttgcaacagaaacgcttccaggcacaatcgaat
ggcactacctatgtctacgatgtgcccgatatgttccgacagatgagcgaacgtcactgg
cgggagttctccaaggctcgtcccacagtcgacatacgcattccggataaaattctcttg
gagtgccaagaacttgtactcgaaggcgataatctggtggagatgcagcgtctacccgga
gagaacaattgcggcatggtagcttggcgcattgtgctggccactccagagtatccaaat
ggtcgtgagatcattgtgatagccaacgatttgacctatctaattggttcctttggcatc
aaagaggatatactctttgccaaggcttctcagttggcgcgtgaacgcaaagtgcccagg
atttacatctctgtcaatagtggagcacgtattggtctagctgaggaagtgaaatctatg
ttccgcatagcatgggaagatcccgaagagccggataagggtttcaagtatctttatctg
tctactgaggactacgctaaggtggccaatctcaattcggtgcgtgccattctaattgaa
gatgagggcgagcagcgctataaaatcaccgatattattggcaaggatgacggtttgggt
gttgagaatttgcgttatgctggtctgattgctggtgaaacatcacaagcctatgaagag
attgtaaccatagccatggtcacttgccgcaccattggcattggctcttatgtggttcgt
ttgggtcagcgtgtcatccagattgataattcgcatataatactcacgggttatgctgct
ctcaataagcttcttggacgcaaggtctatgcctcaaataatcaattgggcggtgtccag
atcatgttcaataatggagttacccacaagactgaagcgattgatctggatggtgtatac
acaattctcgactggctgtcatacattcccgcccacattggctgtgaattgcccattgta
ctaccatgtgatcgtgttgatcgtccagtggatttcatgcctacgaaatctccatatgat
ccacggtggatgcttgccggtagggttaatcctgtcaatgccaacgaatgggaaaatggt
ttctttgatcgcgactcatggagcgaaattatggcaccgtgggccaagactgtggtcacg
ggacgtgctcgtctcggtggtgtcccagttggtgtgattgccgtggagacacgcactgtc
gaagtggaaatgccagccgatccggctaatttggattcagaagccaaaactctgcagcag
gcgggtcaagtatggtatccggactcctcgtacaagacagctcaggccatcaaggacttt
ggacgtgaggaattaccattgattgtgtttgccaattggcgtggtttctccggcggcatg
aaggacatgtacgaacagattgtcaaatttggagcttacattgtggatggactaagggaa
tacaagaagccagtgttgatttatctacctcccaatgccgaactccgaggcggagcctgg
gctgtgctggactctctgatcaatccgcgttacatggaaacctacgcagatccagaggcc
cgaggcggtgttctggaacccgaaggcattgttgagatcaaatacaaagaaaaggatctt
gtgaagaccattcatcggctggatgctaccaccatagcgcttaaacgagaacttgatgaa
gcaactgcagctggggacaaggtgaaggtcgctcagcttgatgaaaagattaaggcccgc
atctcaatactcatgcatgtctatcacacggtggcggttcattttgctgacttgcatgat
accccggaacgcatgctggaaaaggagtgcatcagtgagattgtgccatggagggattct
cgtcgctggctctactggcgtctacgacgtttactgctagaggatgcgcacattaaaaag
atcctgcgggcccaggataatctatccgtaggacaggccaaacagatgcttcgacgctgg
ttggtcgaagaaaagggagccacagaggcatatttatgggataagaatgagcaaatggtt
gcttggtatgaagagcaaaccaaaaatcaagaatccatcgtaaccagaaatgtaaactct
gtgcgaagggatgcaattatttcgacaatttccaaaatgctagaggactgccccgatgtg
gcgctggacgctgtggtgggtctttgccagggcctgacgccagtcaatcgtggagttgtt
gtacgcacactggcacaaatgcaactgaacgaggagtcctcctcgaatacccagggatga

DBGET integrated database retrieval system