KEGG   Drosophila willistoni: Dwil_GK21597Help
Entry
Dwil_GK21597      CDS       T01067                                 

Definition
GK21597 gene product from transcript GK21597-RA
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
dwi  Drosophila willistoni
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dwil_GK21597
Enzymes [BR:dwi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Dwil_GK21597
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     Dwil_GK21597
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1535 aa AA seqDB search
MAKDMEIHSIPISEGQNAEHVLYRLKRGSKLCVHPDSSLLGRKIALYTNYPAEGKKFVRT
EYRLLDWHLKNGKQITTVMHPEAHVVDTDIYAQVELQISGTFRFYFTYAEREVNSTSPPD
GALYVQVEPTLHVGPPGAQKIIPLDSVRCQTVMTKLLGPLNTWESKLRVAKESGYNVIHF
TPIQELGGSRSGYSLRDQLKVSSNCASKKGEKITFEDVEKVIKKCRQEWGVASICDIVLN
HTANESEWLLQHPDATYSCTTCPYLRPAFLLDVALAQCGSDIAAGNLEHVGVPSIIDSEC
HLEALKYQLHNTYLSKVNIYELYQCDVMKYVNEFMTQVRTREPPKNVANESRFREIQLIQ
DPGYRRLASTINFELALDIFNAFHGDCFDEESRFRKCAETLRHHLDDLNNRVRGEIQEYL
NYAIDNCLAGVRYERVQHDGPRVREISEKHSVFMTYFTHTGCLGKSLNEIEKDMYTKAGD
LFMAHNGWVMGSSDPLKDFAEEQPGRANVYLKRELISWGDSVKLRFGRKPEDSPYLWRHM
TEYVETTARIFDGVRLDNCHSTPLHVAEYLLDAARKINPELYVVAELFTNSDGTDNVFVN
RLGITSLIREALSAWDAHEQGRLVYRYGGVPVGGFYANPMRDAASTVAHALFLDLTHDNP
SPVEKRSVYDLLPSAGLVAMACCATGSNRGYDELVPHHIHVVDEERPYQEWGKGVDAASG
IIGAKRALNLLHGQLAEEGFSQVYVDQMDPNVVAVTRHSPISHQTVILVAHTAFSYPDPN
AGPTHVRPLTFEGVLDEVILEASLTMQSDKPFDRPAPFKRSENVINGFTQFKLNLQEHIP
LSKSQVFSTQLSVEGNNTVLHFANLRPGTVVAIRVSMHPGPRNSFAKLQQLTNDLRLGTN
EELQAIVSKLDLPSLSPAIFSCDQEERDLGLGGTAYDIPNFGPLVYCGLQGFVSLLTEIS
PHNDLGHPLCNNLRDGNWMMDYIADRLNNYDELKPLSKWFKDAFEPLKNIPRYLIPCYFD
AIVSGVYNVLVQQVNNLMPSFIRDGHQFPQSLALSTLQFLAVCKSANMPGFSPALSPPKP
PKQCVTLAAGLTHFSTGYMRCWGRDTFIALRGCMLLTGRFNEARFIILGFGECLRHGLIP
NLLDSGKPRFNCRDAVWWWLHSIKQYVESAPKGADILKDKVSRIFPYDDAEPHAPGAFDQ
VLYDVMQEALQIHFQGLQYRERNAGQQIDAHMVDEGFNNHIGVHPETGFVYGGNVFNCGT
WMDKMGSSEKANNRGRPSTPRDGSAVELVGLQYAVLRFMQGLAEKQVIPYTGVERKGPSG
EQTKWSFKEWADRIKENFDKHFFVGDQETCAVANKRGIYKDSHGATQSWTDFQLRCNFPI
TLTVAPDLCNPQKAWRALELAKKHLLAPLGMKTLDPDDWNYRANYDNSNDSTDCTVAHGA
NYHQGPEWLWPIGFYLRARLIFAKKCGHLDETIAETWSILRAHLRELQTSHWRGLPELTN
DNGSYCPDSCRTQAWSIAAILEVLNDLHNLGADVA
NT seq 4608 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagatatggagattcacagcatacccattagcgagggtcaaaatgctgagcat
gtgctgtaccgtttgaaacgtggctccaaattgtgtgtccatccggattcctctctattg
ggtcgtaagattgcactctatacgaattatcctgcagagggaaagaaatttgtgcgtacc
gaatatcgtctattggattggcatttgaaaaatggcaaacaaatcacaacagttatgcat
ccggaggctcatgtggtggacaccgatatctatgctcaggtggaattgcaaatatcgggc
acatttcggttttacttcacttatgctgaaagggaagtgaactctacttcgccaccagat
ggtgctctctatgtccaagtagaacccactttgcatgtgggaccacctggagcccaaaag
attatacctttggattcggttcgttgccagacggtgatgacaaaacttttaggacccctc
aatacctgggaatcaaagttacgtgtggccaaggagtcgggctacaatgtcatacacttt
actcctatccaagaattaggtggctcacgttcaggttactcgctaagggatcagctaaag
gtcagctctaattgtgccagtaaaaagggtgaaaagatcacattcgaagacgttgagaaa
gtcatcaaaaaatgtcgccaagaatggggggtggcctccatttgtgatattgtcttgaat
cacacagccaatgaatcggaatggctattacaacatccggatgcaacatattcatgtaca
acctgtccctatttgcgtccggcttttttgctcgatgttgctctggcccaatgtggcagt
gatattgcagcaggcaacttggaacatgtgggcgtgccttccattatcgattcagagtgc
catttggaagccttaaagtaccaactgcataatacctatctatccaaggtcaatatctat
gaactgtatcaatgcgatgttatgaaatatgtcaatgaatttatgacccaagtgcggact
cgagagccaccgaagaatgtggcgaatgagtcacgctttagggagattcaattgatacag
gatcctggatatagacgcctggctagtactatcaattttgaactggcattggatatattt
aatgctttccatggcgactgtttcgatgaggagtcacgtttccgcaagtgcgccgaaacg
ctgaggcatcatttggatgatcttaacaatcgagtaaggggagagattcaggaatatctc
aattatgccatagacaattgcctggcaggagtacgctatgagagagtccagcatgacggg
ccacgggtacgagaaatatcggaaaagcattccgtattcatgacttacttcactcacact
ggttgtctgggcaaatcattgaatgagatcgaaaaggacatgtacacgaaggctggtgac
ttgtttatggcccacaatggctgggtcatgggctccagcgatccgttgaaagactttgcc
gaagagcaacccggtcgggccaatgtctatctaaagcgagaattgatctcctggggcgat
agtgtgaagctacgctttggtcgtaaaccagaggacagtccctacttgtggcgtcacatg
acggaatatgtggagaccactgcccgcatttttgatggtgttcgtctggataattgtcat
tcaactcccttgcatgtggctgagtatttattggatgctgcccgtaaaatcaatccggaa
ctgtatgttgtggccgaattgtttaccaattccgatggaacggataatgtatttgtcaat
cgcttgggcattacctcactcatacgtgaagctctctccgcctgggatgctcatgagcag
ggaagattggtttatcgctatggtggtgtccccgtgggcggattctatgctaatcccatg
cgtgatgcagcttccactgtggcacacgctttgttcttggacttgacccatgacaatcct
tcgcctgtggaaaagcgctcagtctatgatcttctaccatcggctggtttggttgccatg
gcttgttgcgccacaggaagtaatcgtggctacgatgaactggtaccacatcatatccac
gtggtagatgaagagcgtccttatcaggaatggggcaaaggagtggacgctgcttcgggc
attattggagccaagcgagctctgaatcttctgcatggccaactagccgaagagggtttc
agtcaggtttatgttgatcaaatggatccaaatgtagtggcagtcactcgtcattcaccc
atctcccatcagacggtgatccttgtagcccacacagctttcagctatccggatcccaat
gcaggacccactcatgtgcgtccccttacctttgagggtgttttggatgaggtgattttg
gaggccagtttaaccatgcaaagtgacaagcccttcgatcggccagcaccgtttaagagg
agtgagaatgttatcaatggattcactcagtttaagctgaatctccaggagcacatacct
ctgagcaaatcccaagtgtttagcactcaattgtctgtggagggcaacaatacggtgctt
cactttgcaaatcttcgtccgggtacagtggttgctatacgcgtgtccatgcatcctgga
ccacgcaatagtttcgccaaactgcaacaattgacaaatgatctgcgtctgggcaccaat
gaggaactccaagcgattgtcagcaagttggatcttccctccttgagtccagccatcttc
agttgtgatcaggaggaacgagatttgggcttgggcggcacagcctatgatattcccaac
tttggacccttggtctattgtggcttgcagggatttgtgtcattgctgacggagatttca
ccacacaacgatttgggtcatcctctgtgcaataatctacgtgatggcaactggatgatg
gattatatagcagatcgtctgaacaattatgacgaactgaaaccactttcgaaatggttt
aaagatgcttttgagcccttgaagaatataccacgttacctcataccctgttattttgat
gccattgtaagtggagtatacaatgtgctcgttcaacaggttaacaacttgatgcccagt
ttcatacgcgatggtcatcagtttccccaatcgttagctctctccactcttcagtttttg
gctgtttgcaagtcggccaatatgcctggattcagtccggccttaagtccaccgaaacca
cctaagcaatgtgtcactctagcagctggtttaacccatttctcaacgggttacatgcgt
tgctggggtcgggatactttcatagccctgcgtggctgcatgttgctcaccggccgtttt
aacgaggccagattcattattctgggattcggtgagtgccttagacatgggctcatacca
aatcttctggacagtggcaagcctagattcaattgtcgcgatgccgtgtggtggtggttg
cacagcatcaaacaatatgtggaatctgctcccaagggtgcagacattctcaaggataaa
gtctcccgcattttcccctatgatgatgcggagccacatgctccgggagcctttgatcag
gtgctatacgatgtgatgcaggaggctctgcagattcatttccaaggcctgcaataccgt
gagcgtaatgctggccagcaaatcgatgcccacatggttgatgagggattcaacaatcat
attggtgttcatcccgaaactggattcgtttatggtggcaatgtcttcaattgtggcact
tggatggacaaaatgggttcgtctgagaaggcgaacaatcgcggtcgcccgagtactccc
cgtgatggttccgccgtggagttagttggtctacagtatgctgtcttgcgttttatgcaa
ggactggccgagaagcaggtcataccatatacgggagtggaacgcaaaggcccgtcgggc
gaacaaacgaaatggagcttcaaggagtgggcagatcgcatcaaggagaactttgataaa
catttctttgtcggcgatcaagagacctgtgccgtggccaataaacgaggtatctacaag
gatagccatggagccactcaaagctggacggacttccaattgcgttgcaatttccccatc
actttgacggtggcacccgatctatgtaatccccagaaggcttggcgtgccttggagctg
gccaagaagcatcttctcgctcccctgggcatgaaaactctggatcccgacgattggaac
tatcgtgccaattatgataactcaaatgattcaactgattgcaccgtggctcatggcgcc
aactatcatcaaggaccagaatggctttggccaattggtttctatttgcgtgctcgtctc
attttcgccaagaaatgcggacacttggatgagacaatagccgaaacatggtccattttg
agggctcatctaagggaattgcaaacatcgcattggcgtggcctgcccgagttgacgaat
gataatggatcctattgcccggactcttgtcgcactcaggcctggagtattgccgccata
ttggaggtactcaacgatctacacaatttgggagcagatgtggcataa

DBGET integrated database retrieval system