KEGG   Drosophila willistoni: Dwil_GK21608Help
Entry
Dwil_GK21608      CDS       T01067                                 

Definition
GK21608 gene product from transcript GK21608-RA
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
dwi  Drosophila willistoni
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dwil_GK21608
   00330 Arginine and proline metabolism
    Dwil_GK21608
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Dwil_GK21608
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Dwil_GK21608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 701 aa AA seqDB search
MFKGVPTLANWNLQLLKRSQTSASLLGLRSKATALDLQKDSIEDQLIRTKFGHTGKHLQQ
KIATEKKLRAPPLLNLVFANRKLSFYDTSSTPKVQEDNNAKLNQRRNYSMRPHREQEQRN
AEDVLFDMFASEETGLISMGKFLAGLKTTGIRRNDPRVRELMDNLKKVHKLNNYETGSSA
ETQHLNRETFKAVVAPNIVLIAKAFRQQFVIPDFTSFIKDIEDIYWRCKSNTLGKLADYI
PQLARYSPDAWGVSICTVDGQRFSIGDVEEPFTLQSCSKPLTYAIALEKLGPKVVHSYVG
QEPSGRNFNELVLDQNKKPHNPMINAGAILTCSLMNALVKPDMTSAEIFDYTMSWFKRLS
GGEYISFNNAVFLSEREAADRNYALGFYMRENKCFPKRTNLKEVMDFYFQCCAMETNCEA
MSVIAASLANGGICPTTEEKVFRPEVIRDVLSIMHSCGTYDYSGQFAFKVGLPAKSGVSG
GMMLVIPNVMGIFAWSPPLDHLGNTVRGLQFCEELVNIFNFHRYDNLKHLSNKKDPRKHR
YETKGLSIVNLLFSAASGDVTALRRHRLSGMDITLADYDGRTALHLAASEGHLECVKFLL
EQCHVPYNPKDRWGNLPVDEAENFGHTDVVDYLKSWAEKSTDAPQECTPEAVTTTTAADE
ELCSTSDLDRSATSSPVLSNSPVPSEADSVTSRDDKTKPGL
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaggtgttcccacgctagcgaattggaatttgcaattattgaaaaggtcccaa
acgtcggcatcattgttgggtctacgttcaaaggccacggctttggatttgcaaaaggat
tccattgaggaccaattgatacgaaccaaatttggtcataccggcaaacatttgcaacag
aaaattgccaccgagaagaaattacgtgcaccgccgttgctgaatttggtttttgccaat
cggaaattatccttctatgacaccagctcgacacccaaagtacaagaagataataatgcc
aaactcaatcagcgacgcaactattcgatgcggcctcatcgcgaacaggagcagcgaaat
gccgaggatgtgctcttcgatatgtttgccagcgaggagacaggactcatatcgatggga
aaatttctggctggcctgaagacaactggcataaggcgcaatgatcctcgagttcgggag
ctaatggacaatttgaagaaagtccataaattgaataactatgaaacgggttcctcggca
gagacacaacatttgaatcgagagacctttaaggctgtggtcgcccctaatattgtgtta
attgccaaggcattccgtcaacaattcgttatacccgatttcacaagcttcattaaggac
attgaggacatttattggcgttgcaagagcaatacattgggtaaattggccgattatata
ccacaattggcacgctatagtcctgatgcttggggtgtcagtatttgcactgtggatggt
caaaggttttccattggcgatgttgaagaaccctttaccctgcaaagttgcagtaaaccc
ctgacctatgccattgccctggagaagctgggccccaaagtggtgcactcgtatgtgggt
caagagccaagtggtcgaaactttaatgaattagtcttggatcagaataaaaaacctcat
aatccaatgatcaatgctggagcaattttaacttgctctttgatgaatgctttggtcaag
ccggatatgacatcggcggagatttttgattataccatgtcgtggtttaagcgtttatcg
ggcggtgaatacattagtttcaataacgctgtattcctatccgaacgcgaggcggcggac
agaaattacgccctgggcttttatatgcgtgagaataagtgcttcccgaaacggactaac
ctcaaggaggtaatggatttctatttccaatgctgcgcaatggaaacaaattgcgaggcc
atgtcggttatagcggcaagtttggccaatggtggcatttgtcccaccaccgaagagaag
gtctttaggccagaggtcatacgcgatgttctttccattatgcattcatgtggaacttat
gattattccgggcaatttgcctttaaagtgggtttgccagccaaatcgggtgtgtccggt
ggcatgatgctggtcatacccaatgtaatgggcatttttgcctggtccccgccattggat
cacttggggaacactgtacgcggtctgcaattctgtgaggaactggtgaacattttcaat
ttccatcgttatgacaatttgaagcatttgtcgaataagaaggatccccgcaaacatcgc
tacgaaaccaagggtttgtctattgtcaatttattattctcggctgccagtggagatgtc
acagcattgcgtcgtcatcgcttgagtggcatggatatcactttggccgattatgatgga
cgcactgcattgcatttggccgcctcagagggtcatttggagtgtgtgaaatttttacta
gaacaatgccatgtcccctataatccgaaagatcgttggggtaatttacccgtcgatgaa
gcagagaatttcggtcataccgatgtggtggattatctcaagagttgggctgaaaaatcc
acggatgccccgcaagaatgcactccggaggccgtaacgacaacaaccgcagctgatgag
gaactgtgcagcaccagcgatttggatcgtagtgccacatccagtcccgtattgagtaac
agtccagtgccatcggaagcggacagcgtaacgagcagagacgataagaccaagccagga
ctatag

DBGET integrated database retrieval system