KEGG   Drosophila willistoni: Dwil_GK21665Help
Entry
Dwil_GK21665      CDS       T01067                                 

Definition
GK21665 gene product from transcript GK21665-RA
Orthology
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.1.2.15]
Organism
dwi  Drosophila willistoni
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1309 aa AA seqDB search
MGTTKEQQHQQQQNEGDADASTTHTSQSQSTTTAPAPAPAPTSEVLIIPATQASTLATNA
AKKIRRAFSMPRNPFRWSRKFKTTAQGVGGVGGGGGGGGPGGGVAAAGKDNNGSNSAISF
CVSGGRGRSGSIVSLNSYEAASERVTTSNSNNNNNNNTSSNTTTTTNSSSNNNNNNQKRS
RALRRSSFRKFLNRIAQHLSSGINVGSAEDNNSAGCNRITLIEIVPFYTGCWRRKEANKN
GQTAVGLGTTTTGNGSAGGGVGGGERVPPIGGYQWPADQTPGVMGLKNHGNTCFMNAVLQ
CLSHTDILAEYFVLDQYKADLKRRNKINSRKFGTKGELTEQLANVLKALWTCRNESDHST
GFKAVVDRYGSQFRSSTQHDAQEFLFWLLDKVHEDLNTASKRRYKSIKNSYGRSDEIIAA
ETLANHIRCNNSFVQAVFQAQFRSSLTCPRCKKQSNTFDPFHCISVQLPQLTQQTIFVTV
VYMKQQPRQIKMGLRVPAGSPIVALREQLQTDTGIAASRMVLVDLNAEGFTRVFYDTQPV
ETLCSIETIYCIEVPEATPVPKSVNTPTPAPVKDGAEKSSVSAGGQAAPTPDLLLLVANV
KRDKNAKECLRFGAPFSMKAPRDCSYQELQKRMLREISTLLKPEVFSYATPLTDMFRIRL
QDPSADPDTYLEQVEHPLLTEMIDMALSVLSTEAGPPHIKLLLEWSSPEDHFVKLQQEEL
VEHESVARLSASKPKDTASLTLEQCLEHYTKAETLSAEDAWRCPHCQQYLPVVKTLGLWS
LPDILVVHFKRFRQHQSKGPQAAKLTTMVKFPLNAFDMSPHLARGFHESNSNSLGLDARS
NSGNLWKKARSSGDSRSSTLNSRNEPKDTRYDLYAVCYHQGDTLETGHYTAACKNPYDRQ
WYKFDDQRVSKVPEDAIEEDIINNEAYMLFYQRRSVDAGECSGSSSNSGDHWVSKITPAT
SVSNSGKEKPDASIPSNEVAPPAAAAELETAAAPTEKAQSKPVDIPKVCQDTDEVTPMEV
EELVVVEPKQVALNVEDLAFADADIEVEKTKTESNSLPVDTPPVASQEPEIAMEEATQIF
AMDEDDCTELKSEALEELVIPKEPSIESQLVSPIAEIKTNGHASASPTSSSSSASSVASL
SSSSSPRSLTTSVTAASTLQNKFNGSYGPTAAALFNGQATPQLSSSLQLSRQVLHNHCNS
NHNWHGSRSSVSAVENATQQQQAAAASISLRHSFSTSSNYKLRECSETLSSLLRNSANTC
SKDTLLFIDQQSHHHTSGLIEDDDDTYMGRSLWISPVTPHKLITVSPKN
NT seq 3930 nt NT seq  +upstreamnt  +downstreamnt
atgggcacaacaaaagagcagcagcaccagcaacaacaaaatgaaggcgatgccgacgcc
agcaccacccacacttcgcagtcgcagtcgacaacgacggcgcccgcaccagcgccagcg
ccgacgtcagaggttttaatcattcctgccacacaggcctccacattggccacaaatgcc
gccaaaaaaatacgccgagccttctcaatgccacgcaatccatttcgttggtcccgcaaa
ttcaagaccacagcacagggtgttggaggagtgggaggaggaggaggaggaggtgggcct
ggtggaggagtcgctgcagccggcaaggataataatggcagcaattcagccatttctttt
tgcgtcagtggcggacgtggtcgcagtggcagcattgtgtctctcaatagctatgaagca
gcctccgaaagagtcaccaccagcaacagcaacaacaacaataataataatacaagcagc
aatactactactactactaacagcagcagcaacaacaacaacaataaccagaaacggtca
cgtgctctacgtcgttcgtccttcaggaaatttctaaatcgcattgcccagcatctgagc
tctggcataaatgtgggttctgcagaggataataactctgctggctgtaatcgtataaca
cttatagaaatcgtgccattctataccggatgctggcgcagaaaagaggctaataaaaat
ggacaaactgctgttggcctgggtacgacgacaacgggaaatggatctgctggtggtggt
gttggtggtggggaacgtgtgccccccattggtggctatcaatggccggctgatcaaacg
ccaggtgttatgggtcttaaaaatcatggtaacacctgtttcatgaatgcagttctgcag
tgtctcagccatacggatatattggccgagtattttgtattggatcagtataaggccgat
ttgaagcgtcgcaataaaatcaattcacgtaaatttggcaccaaaggtgaactaaccgaa
caattggccaatgttttgaaggctctgtggacctgccgcaatgagagtgatcatagcaca
ggcttcaaggctgtggtcgatcgttatggttcacaatttcgcagttccacacagcatgat
gcccaggagtttctattctggttgctggacaaggtgcatgaggatttaaatacggccagc
aagcgacgctataagagcataaagaattcctatggccgttcggatgagataatcgccgcc
gagacactggccaatcatatacgctgcaataatagctttgtccaggctgtatttcaggct
cagtttcgctcttcgctgacctgtccgcgttgcaagaagcaatcgaatacctttgatccg
ttccattgcatttcggtgcaattgccccaattgacgcagcaaacgatattcgtaaccgtc
gtctatatgaaacagcagccacgtcagatcaagatgggtctgcgggtgccggcgggttcc
ccaattgtggcactgcgcgaacaactgcaaacggacacgggcatagcggcctctcgcatg
gttctggtggatcttaatgctgagggattcacgcgcgtcttctatgacacgcagccggtg
gagacgctatgcagcattgagactatctattgcattgaagtacccgaggcaactccagtg
ccaaagtcggttaacacaccgacaccggctccggtcaaagatggggcagagaaatccagt
gtttcggcgggaggtcaggcggctccaacgccggatctgctactccttgtggccaatgtt
aagagggataagaatgccaaagagtgtttacgtttcggagccccgttcagtatgaaagct
ccgcgagattgctcctatcaggagttgcagaaacgtatgttacgtgaaatttccacgctg
ctcaagccggaggttttctcctatgccacaccactcaccgatatgttcagaatacgactg
caggatccgtcagccgatccggacacttatctggagcaggtggagcatcctctgctaacc
gaaatgattgatatggccttgtcggttctctccacggaggcagggccgccgcacattaaa
ctcctgctcgaatggagctcccctgaggatcatttcgtaaagctccagcaagaagagttg
gtcgaacacgagagcgtcgctcggctgagtgccagcaaaccaaaggacacggcttcgctg
actttggagcagtgtctggaacactataccaaggcggagacgcttagtgccgaggatgca
tggcgttgtccacactgccagcaatatttgccagtggtaaagaccttgggcctctggtca
ttgcctgatattttggtggtgcatttcaaacgcttccgacagcatcaatcgaaaggtccg
caggcggccaagttaaccacaatggttaaatttccgttaaatgcttttgatatgtcgccg
catttagcgcgcggtttccatgagagcaatagcaactccttgggcttggatgcccggagt
aatagcggaaatctctggaagaaggcacgctcctcgggcgattcacgctcctccacgctc
aattcccgcaacgagcccaaagatacacgttacgatctgtatgccgtgtgctatcaccag
ggtgacactttggaaacgggacactatacggctgcttgcaagaatccctacgatcgccag
tggtacaaattcgatgatcagcgtgtaagcaaagtgcccgaagatgctatcgaagaggac
atcatcaacaatgaggcctacatgttgttctatcagcggcgcagtgtcgatgccggcgaa
tgctcgggttccagttcgaattcgggtgatcattgggtatccaaaataaccccagcgaca
agtgttagcaacagtggaaaggagaaaccagatgcttcaattccatccaatgaggtggcg
cctcctgccgctgctgctgagctagagacagcagcggcgcctacagagaaagctcaatcc
aaaccagtagatatacccaaagtttgtcaggatactgatgaagtcacccccatggaagtg
gaggaactcgttgtggtggagccaaaacaggtggctcttaatgtggaggacttggctttt
gccgatgccgatattgaagtggagaagacaaaaactgaatccaattctctgccagttgac
accccaccagttgcctctcaagagcctgaaattgccatggaggaggcgacacaaatattt
gccatggacgaggatgattgcacagagctcaaatcagaagcattagaggaacttgtgata
ccaaaggaaccatctattgaaagccaacttgtatctccgattgctgagatcaagaccaat
ggacatgcgagtgcttcacccacatcctcatccagttcagcctcatcggtggcatcgtta
tcatccagttcatcgccgcgttcgttgaccacatcggtgacggcggcatccacattgcag
aataaattcaatggctcatatggcccaactgccgccgccctcttcaatggccaggccaca
ccccagctatcgtctagcctacaattgtcacgccaggttttgcataatcactgcaacagc
aatcacaactggcatggatcacgcagcagtgtgtcggctgtggaaaatgccactcaacag
cagcaggcagcagccgccagcattagtttgcgtcactctttctccaccagctccaattac
aagttgcgcgaatgcagtgagacattatcctcgctgttgcgcaactcggccaatacttgc
agcaaggatacgctgctatttatcgatcagcagagtcatcatcatacatcgggactgatt
gaggacgatgatgatacctatatgggtcgatccctgtggatttccccagtgacgccacac
aaactcataaccgtttcgcccaagaattag

DBGET integrated database retrieval system