KEGG   Drosophila willistoni: Dwil_GK21691Help
Entry
Dwil_GK21691      CDS       T01067                                 

Definition
GK21691 gene product from transcript GK21691-RA
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
dwi  Drosophila willistoni
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dwi00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dwi00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dwi00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:dwi00603]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dwi04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 417 aa AA seqDB search
MYTSLGQLLIVSVLFSQSLVNALDNGLARKPPMAWMSWQRFRCITDCETYPNECISEKLF
SRHADLLVSEGYADAGYEYIIIDDCWLEKERDNKTQKLVANKERFPSGLNALADHIHDKG
LKFGLYQDFGTNTCAGYPGVINHMALDAQTFADWDVDYVKLDGCYANLTDMVDGYPEFGR
LLNATGRPMVYSCSWPAYQEDEGQMPDYESLKKHCNLWRNWNDIDDSLESVMQIMDYFSK
NQDRIQPHAGPGHWNDPDMLILGNYGLSYDQSKLQMAIWSIMAAPLIMSNDLAHVRPEIK
EILQNREVIAVDQDELGIQGRRIILRNDIEVWRRPITPKTTSGEYSYALAFVSRRTDGAP
YAIKFTLQELGLHNDGGYDVRDLYVKTNNKLGVFSASSQFATRVIPNGVTFYKFTAL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtacacatctttgggtcaattacttatcgtcagtgtgttgtttagtcagagcctggtc
aatgctctggataatggtttggcccgcaaaccacccatggcctggatgtcctggcagcgt
tttcgttgcataaccgattgtgaaacctatccaaatgagtgcataagtgaaaaattattc
agtcgacatgctgatctactggtgtcagagggttatgccgatgctggctatgagtatatc
attatagacgattgttggctggagaaggaacgtgataataaaacacaaaaattggtggct
aataaagaacgttttcccagtgggctaaatgccttggctgatcatattcatgacaagggt
ttgaaatttggtctatatcaggactttggcactaatacatgtgccggttatcctggcgtt
atcaatcacatggccctggatgctcagacctttgccgattgggatgtggactatgtgaaa
ttggatggctgctatgccaatctcacggatatggttgatggttatcccgaatttggtcgt
ctattgaatgccactggtagacccatggtctattcatgcagttggccagcatatcaagag
gatgagggtcaaatgcccgattatgaatcattgaagaaacattgcaatttgtggcgcaat
tggaatgacattgacgattcattggaatcggttatgcagattatggattatttttccaaa
aatcaggatagaattcaaccccacgcaggtcctggacactggaatgatccggatatgctt
atcctgggaaattatggtcttagctatgatcaaagtaaacttcaaatggccatttggtcc
attatggctgctccactaattatgtccaatgatttggctcatgttagaccagaaattaaa
gagattttacagaatcgtgaagtcattgctgtcgatcaggatgaactaggcattcaggga
cgtcgcattattttgcgtaatgatattgaagtctggcgtcgtcccattacgcccaagacc
acttctggagaatactcatatgctttggctttcgtcagtcgtcgaacagatggagctccc
tatgccattaagtttacccttcaagagcttggcttgcacaatgatggcggctacgatgtc
cgagatttgtatgtcaagaccaacaataaattgggtgttttcagtgcttcaagtcaattc
gctacacgtgtgattccaaatggtgtcactttctacaagtttacagcgctttaa

DBGET integrated database retrieval system