KEGG   Drosophila willistoni: Dwil_GK21844Help
Entry
Dwil_GK21844      CDS       T01067                                 

Definition
GK21844 gene product from transcript GK21844-RA
Orthology
K04437  
filamin
Organism
dwi  Drosophila willistoni
Brite
Exosome [BR:dwi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dwil_GK21844
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1379 aa AA seqDB search
MNKIIDKPIDKLLNFNKTTNDQHISKLISGPAGQSVPAQVHQSAEGVFKAEFVPRVVGEH
RVNVTVNGLPTAGSPYAAKVYDVSAIKVKNVSSGTVGKAVTFLVETSQAGPGNLEVTVNG
GRVPTSAQAQGQHTYAISFTPREAESHTVELRFNSQDVPGSPFTCRVAAAARIQSPETMD
KVSVGRLFEFVVESDTKPTVEVLGPARRSVPVKIDPLGSTTLGYNVKFEPIEVGDHSVEV
RLPGGGHVEGSPFLLKAYSAEKVIVTDIRPGVVNKSVSFGINASQAGAGNLEIIVAVNGK
NVPNFVQSEGNARFKVNFKPTEAASHSLSVRFNGHPVPGSPFSCHIAAASSSSSMGLPRA
QAMGECLKQAAVKMDNTFELEGFDGVEPQIFVTSPSGDNEHCQLSQHDGGSYSASFRPTT
VGRHLISVTANDQHINGSPFSCNVFDVSRVSISGLDQQYGPATLGVPVTFSVDAAGAGEG
TLELVVSTDSSTVKAEVVACARGLYDVTFVPQSTEPHYVNITFNEVAVDGSPFRVDIQQH
TQHIQIGSLAAIDFPADDQIVEILSPDQKNVPYTINRQTAEFRTHQTGNYTLRFIDRETR
QHIGSRTLCIFDPSLVKIGEVSEAFCHRPASIGVSLNEAGQGDLSALVRCGATEVAHTIR
GPSKTGVYEIVYQPTRVAPHKISILFNDVPISLKPLEINVLPASAGKEISVSGLGLYQAR
VGKTTSFAIDTVKRPAREFDVVVSGPGGQALPVRCYQTKNGHLQAEFTINKPGQCVIEVL
HQSKPLPGSPFTCESFDSSKVSTQGVTKEPLALHSPNSFTVRTDNAGTAELEAFAISPSN
QSIPVLISEQSEGIYNVEFVPSQPGNYKLTVMYGGETIASSPLNFTASSSGVRNDARAAG
HGLEVCHRNKEASFVVYCPIAPNVQIERVDEFGERIEPKIKALGNNEWRISYTILSVGKY
EIRASCPNRGSLPGSPWHISCVESNKVTPVGGWGTLVDHDGRLILPARIVFDVENAGPGK
LVCSIDGIEIPVDKMPDDKMCLNITGENLAAGEHDLDLTWSGLTITQCPRSAFVTGQLAA
DKVQLMGRGLAAAQAGEAAHFTIDASNAPAGRPEVILLTSQDNTSLPVSLAQPRPSENIW
LASYTPQKSTTGTLTLSVKWNGRLVKGCPLTVAVGSSMDASKVIASGEGLRHGIVGKDIK
SWIDTRRAGPGELTAHCAGVRKVAYCELYDHGDATFTLNIKPQEPGRHLLTIKYGGQNVP
GSPFALKVAGAPDASKVRVYGPGIEHGVLATFQSRFICDTRGAGAGQLTVRVRGPKGAFR
VEMQRESQKDRTILCKYDPTEPGDYRVEVKWAGEFVPGSPFPVMIFDTEEELRRYLQGI
NT seq 4140 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaataatcgataaaccgatcgataaacttttgaatttcaacaaaacaaccaac
gatcaacacatatcaaaactcatttccggacctgccggtcaatcggttccggcacaagta
catcaatcagctgaaggcgttttcaaggcagaatttgttccccgtgtggtcggcgaacat
cgtgtgaatgttaccgtcaatggtttacccacagctggtagtccttatgcggcaaaggtt
tatgatgtcagcgctataaaggtgaaaaatgtgagcagtggcactgtgggtaaagctgtc
acatttctggtggaaacaagtcaagccggtcctggtaatcttgaagtcactgtgaatggt
ggacgtgtaccgacatcggctcaggcccagggtcagcacacatacgccattagttttact
cctcgcgaggcggagagtcatacggttgagctacgcttcaatagccaagatgtgcctggt
tctcccttcacttgccgggtggcagctgctgctcgtattcaatcgccggaaactatggac
aaagtcagcgtgggacgtctatttgaatttgtggtggagtcggataccaaaccgaccgtg
gaagttctgggaccagccagacgcagtgtacctgtcaaaattgatcccttgggttcgacc
accctcggctacaatgtcaaatttgaacccattgaagtaggcgatcattcagttgaagtt
cgtctaccaggtggtggtcatgtcgagggaagtcccttcctactgaaggcttactccgcc
gaaaaggtgatcgtcacggacatccgtcccggagttgtcaataaaagtgtgagctttggc
atcaatgcctctcaggcgggagctggtaatctagagatcattgttgctgtcaatggaaag
aatgtgcctaattttgtccaatctgagggcaatgccagattcaaggtgaactttaagccc
accgaggcagcttcccattcgttatcagtgcgtttcaatgggcacccagtgccaggatcc
ccctttagctgtcacatagccgcagcctcatcgtcttcctcgatgggtttgccacgtgcc
caggccatgggcgaatgcctcaaacaggctgctgtcaaaatggataataccttcgagctg
gagggtttcgatggtgtggaacctcaaatatttgtcacctccccctctggtgataacgag
cattgccagttgagccagcatgatggcggtagctactctgcttcgttccgccccaccaca
gtgggtcgtcatttgataagtgtgactgccaatgatcagcatattaatggctcacccttc
agttgcaatgtctttgatgtctctagggtgagcattagtggtctggatcaacaatatggc
ccagccactttgggggtgccagttaccttcagtgtggatgcagcaggagcaggcgaaggc
acgttggagctggtcgtttcaactgatagcagcactgtcaaagctgaggttgtggcctgt
gcgagaggtctatatgatgtcacatttgtcccacagagcactgagccgcactacgtgaac
atcacgttcaatgaggtggccgtagatggtagtcccttccgcgtggacatacaacagcat
actcaacacattcagataggtagtctggctgccattgattttcccgcagatgatcagatt
gtagagattctttcaccggatcagaagaatgttccctataccattaatcgtcaaactgct
gaattccgtacacatcaaacgggaaattacacactgcgtttcatcgatcgcgaaacacgt
cagcacattggctctcgtactttatgcatctttgatccaagtctggtgaagatcggcgaa
gtcagcgaagccttttgccatcgtccagctagtataggggtctctctcaatgaagcaggt
cagggagatctctcggctctggtgagatgcggtgccaccgaagtggctcacactattcgc
ggaccgagtaagacgggagtctatgagattgtctatcagcccacacgagtggctccacac
aagatcagcattcttttcaatgatgttcccatatcgctgaagccactcgaaattaatgtg
ctaccagccagtgcgggcaaggaaataagtgttagtggcttaggtctttatcaggcccga
gtaggcaagacaacatctttcgccatcgataccgtgaaacgtccagccagagaattcgat
gtggtggtatctggtccaggtggacaggctctgccagtgcgctgctatcagaccaagaat
gggcacttgcaagcagagttcaccatcaacaagccgggacagtgtgttattgaggttctt
catcagtccaaaccattgccaggcagtcccttcacatgcgagtccttcgacagcagtaaa
gtgtccactcaaggcgtcactaaagaaccgttggcccttcacagtcccaacagctttaca
gtgcgcacagataatgctggcaccgccgaactggaagcctttgccatttcgcccagcaat
cagagtattccggtgcttatcagtgagcaatccgagggtatctacaatgtggaattcgtg
ccctcccaaccgggtaactacaagttgaccgtaatgtacggtggcgagacaatagccagc
tctcccctgaacttcaccgcctcttcgagtggcgtaaggaacgatgcacgagcagctggt
catggcttggaagtgtgccatcgcaacaaagaagcttcttttgtggtttactgtcccatt
gcgccgaatgttcaaatcgaaagagtagatgaattcggtgaacgcatcgagccaaagatc
aaggccctgggtaacaatgagtggcgcatttcatatacgattctctcagtgggtaaatat
gaaatccgtgccagttgcccgaatcgaggaagtttgcccggctcgccctggcacatcagt
tgcgtggaatcgaataaggtcacaccagtcggtggctggggtacgttggtggatcatgat
ggtcgcttgattctacccgctcgcattgtcttcgatgtagaaaatgcgggacctggaaaa
ttggtgtgcagcattgatggcattgagatcccagtggataagatgcccgacgacaagatg
tgcctgaacatcaccggagagaatttggctgctggcgagcatgatttggacttaacttgg
agtggtctgaccatcacccaatgtcccagaagtgccttcgtcactggccaattggcagcc
gataaagtacagctgatgggtcgtggtctggccgctgcccaagctggcgaggcagctcac
tttacgattgatgcatctaatgctccggctggccgtccagaggtcatacttcttaccagc
caggacaacacctcgctgcctgttagcttggcccagccacgacccagcgagaacatctgg
ctagcctcctacacgccacaaaagtccacaacgggcactttgaccctttcagttaaatgg
aatggccgtcttgtcaaaggttgtccgctcacggtggccgttggctcttccatggatgcc
tctaaggttatagcctccggtgagggactacgacatggcatagttggcaaggatatcaag
tcctggatagacacaagacgtgctggtcctggcgaacttacagcccattgtgctggcgta
cgcaaagttgcctattgtgaactctatgaccatggtgatgcaactttcacgctcaatatt
aaacctcaagagccgggtcgtcacttgctaactatcaagtatggcggtcagaatgtgccc
ggctcgccatttgccttaaaagttgccggtgctccagatgccagcaaggtgcgagtctat
ggtcctggcatagagcatggtgtgctggccacctttcagtcgcgtttcatatgcgacaca
cgtggagctggtgctggccagttgaccgtgcgagttcggggacccaaaggagccttccgt
gtagaaatgcagcgtgagagccaaaaggaccgaaccattttgtgcaaatacgatcctacc
gaaccaggtgactatcgcgtggaagtgaaatgggctggagaatttgtgcccggctcacca
ttccctgttatgattttcgacactgaggaggaactacgaagatatttacagggcatatga

DBGET integrated database retrieval system