KEGG   Drosophila willistoni: Dwil_GK21870Help
Entry
Dwil_GK21870      CDS       T01067                                 

Definition
(RefSeq) GK21870 gene product from transcript GK21870-RB
  KO
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
dwi  Drosophila willistoni
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    Dwil_GK21870
   00514 Other types of O-glycan biosynthesis
    Dwil_GK21870
Enzymes [BR:dwi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     Dwil_GK21870
Glycosyltransferases [BR:dwi01003]
 Terminal extension
  Sialyltransferase
   Dwil_GK21870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 461 aa AA seqDB search
MWQVKRALPLAHGQALISLYVLLIASGLIIQSVGAGQEIASKAQQRHEPHNGEVNTSNGD
NNGKGVVTFNLRRLPRSVFHVRWNPNEKFIVESHENPAINSSKLAPHPRLKVSKNTKLTL
SPKLYLCHDKYSDLCSNKTQQFRQRIVQTFQKAMRETQHNETIDQNHYNVDYKPVFGDSF
EEQYYPSTCLVMEAGVRVLRRKDPPFNKLAFGKLFPRQRLFRNIKNIKTCAIVSSAGSLA
GSKLGRFIDTHDIVMRFNHAPTQGHEVDVGSKTTIRVVNSQVVTKPEFDFPHAPIFRNVT
IAAWDPGKYNGTLEDWLTTADYDLFTNYEIYRRRYPKSRAFLIDPHSVWRLWQSLQMFAG
NRPIKRNPPSSGFIGLALLLPHCPQVDFIEYVPSTRLNGRCHYYSKEMNSACTFGSWHPL
AAEKLMALDMNMADDMSVFQFGILRIRQPDKLLCGFNFFGY
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaagtgaaacgcgcattgccactagcacatggccaggcgttaatcagtctctac
gttctgctcattgcaagcggattaataattcaatcggtgggggcgggtcaagaaattgct
tcaaaagctcagcagagacacgaaccacacaatggcgaggtgaatacatcaaacggcgat
aataatggtaagggagtggttactttcaacctaaggcgattgccacgaagtgtgtttcat
gtacgttggaatcccaatgaaaaattcattgtcgagagtcatgagaatccggcaattaac
tcctctaaattggccccacatccgagattaaaagtttccaagaataccaaactaacactg
agtcccaaattgtatttgtgccatgataaatattcggatctctgttctaataagacgcaa
caatttcgtcaacgaatcgtgcaaacattccagaaagcaatgagagagactcagcataat
gagacaatcgatcagaatcattacaatgtggactataagccagtttttggagatagtttc
gaggagcaatactatccctccacatgcctggtaatggaggcgggagttcgtgtccttcgt
cgcaaggatccaccgttcaataaactggcatttggcaaactatttcccaggcagcgactc
tttcgaaatatcaagaatattaaaacctgtgccattgtgtctagtgctggttctctggct
ggctccaagctgggtcggtttatagacacgcatgacattgtgatgagattcaatcatgcc
cccacacaaggacacgaggtggatgttggcagcaaaaccacaattcgtgtggtgaatagt
caagtggtcaccaagccggaatttgattttccccatgctcccattttccgtaatgtcacc
attgctgcctgggatccaggcaaatataatggaactctcgaggactggcttaccacagcg
gactatgatctatttaccaactatgagatatatagaagacgctatcccaagtctagagcc
tttctaattgatccacattcggtgtggcgtctgtggcaaagtctgcaaatgtttgccggc
aatcgacccatcaaacgtaatccacccagctccggttttataggactggccctacttttg
ccccattgtcctcaggtggattttattgagtatgtaccatctactcgtctcaatggacgt
tgtcattactacagcaaggagatgaattcggcttgtacgtttggctcttggcatccattg
gccgctgagaaattgatggcattggatatgaatatggccgatgatatgtccgtatttcaa
tttggcatattgcgtatacgacaaccagataaattgctatgcggtttcaatttctttggc
tactaa

DBGET integrated database retrieval system