KEGG   Drosophila willistoni: Dwil_GK21906Help
Entry
Dwil_GK21906      CDS       T01067                                 

Definition
GK21906 gene product from transcript GK21906-RA
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dwi  Drosophila willistoni
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dwil_GK21906
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Dwil_GK21906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 321 aa AA seqDB search
MSFTRQLSEMSASELNDAIDDTNFPQAHILSRGRNNSICSTSSTSEAGAAPPVATSPTDE
VVANVSASASAITPPTRPRLILKTTNGSSNANSVIDNDGTQPQTPMTPRTSTTPGHEKCT
FHHDLELDHKPPTREALLPDMARSYRLLLGGLGENPDRQGLIKTPERAAKAMLYFTKGYD
QSLEDVLNGAVFDEDHDEMVVVKDIEMFSMCEHHLVPFYGKVSIGYLPCNKILGLSKLAR
IVEIFSRRLQVQERLTKQIAVAVTQAVQPAGVAVVVEGVHMCMVMRGVQKINSKTVTSTM
LGVFRDDPKTREEFLNLVNSK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagttttacacgccaactatccgagatgagtgcaagcgaactaaatgatgccattgat
gatacaaatttcccgcaagctcatatcctttcacgtggacgcaacaatagcatttgttca
acaagtagcacatcggaggctggagcagctccaccagtggcaacatcacccacggatgaa
gtcgtggccaatgtcagtgccagtgccagtgccataactccacccacacgtccacgctta
atattgaagaccaccaatgggagcagcaatgccaatagcgttattgataatgatggtaca
caaccgcaaacaccaatgaccccacgtacatcaactactccaggccatgaaaaatgcact
tttcatcatgatttggagctggatcataagccacccacacgtgaggctctgttgcccgat
atggcccgttcctatcgcctgctattaggtggactgggcgagaatcctgatcgtcaagga
ctaataaagacaccagaacgtgctgccaaggcaatgctgtactttaccaagggttatgat
cagagtcttgaggacgtccttaatggcgctgtgttcgatgaggatcacgatgaaatggtt
gttgtcaaggacattgaaatgttttccatgtgcgaacatcatttagtgccattctatggt
aaggtatccattggttatttgccctgcaataagattcttggcctcagcaagctggcacgt
attgtggaaatcttttcgcgtcgtttgcaagttcaggagcgtctaacgaaacaaattgct
gtcgcagtaactcaggcagttcagccagctggtgtggctgttgttgttgagggcgttcac
atgtgcatggtgatgcgtggtgtgcagaagatcaatagcaaaaccgttacctcgactatg
ttgggcgttttccgggacgatcctaagacccgggaggaattccttaacttagtcaatagc
aaatag

DBGET integrated database retrieval system