KEGG   Drosophila willistoni: Dwil_GK21906Help
Entry
Dwil_GK21906      CDS       T01067                                 

Definition
GK21906 gene product from transcript GK21906-RA
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dwi  Drosophila willistoni
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dwi00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 321 aa AA seqDB search
MSFTRQLSEMSASELNDAIDDTNFPQAHILSRGRNNSICSTSSTSEAGAAPPVATSPTDE
VVANVSASASAITPPTRPRLILKTTNGSSNANSVIDNDGTQPQTPMTPRTSTTPGHEKCT
FHHDLELDHKPPTREALLPDMARSYRLLLGGLGENPDRQGLIKTPERAAKAMLYFTKGYD
QSLEDVLNGAVFDEDHDEMVVVKDIEMFSMCEHHLVPFYGKVSIGYLPCNKILGLSKLAR
IVEIFSRRLQVQERLTKQIAVAVTQAVQPAGVAVVVEGVHMCMVMRGVQKINSKTVTSTM
LGVFRDDPKTREEFLNLVNSK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagttttacacgccaactatccgagatgagtgcaagcgaactaaatgatgccattgat
gatacaaatttcccgcaagctcatatcctttcacgtggacgcaacaatagcatttgttca
acaagtagcacatcggaggctggagcagctccaccagtggcaacatcacccacggatgaa
gtcgtggccaatgtcagtgccagtgccagtgccataactccacccacacgtccacgctta
atattgaagaccaccaatgggagcagcaatgccaatagcgttattgataatgatggtaca
caaccgcaaacaccaatgaccccacgtacatcaactactccaggccatgaaaaatgcact
tttcatcatgatttggagctggatcataagccacccacacgtgaggctctgttgcccgat
atggcccgttcctatcgcctgctattaggtggactgggcgagaatcctgatcgtcaagga
ctaataaagacaccagaacgtgctgccaaggcaatgctgtactttaccaagggttatgat
cagagtcttgaggacgtccttaatggcgctgtgttcgatgaggatcacgatgaaatggtt
gttgtcaaggacattgaaatgttttccatgtgcgaacatcatttagtgccattctatggt
aaggtatccattggttatttgccctgcaataagattcttggcctcagcaagctggcacgt
attgtggaaatcttttcgcgtcgtttgcaagttcaggagcgtctaacgaaacaaattgct
gtcgcagtaactcaggcagttcagccagctggtgtggctgttgttgttgagggcgttcac
atgtgcatggtgatgcgtggtgtgcagaagatcaatagcaaaaccgttacctcgactatg
ttgggcgttttccgggacgatcctaagacccgggaggaattccttaacttagtcaatagc
aaatag

DBGET integrated database retrieval system