KEGG   Drosophila willistoni: Dwil_GK21909Help
Entry
Dwil_GK21909      CDS       T01067                                 

Definition
GK21909 gene product from transcript GK21909-RA
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dwi  Drosophila willistoni
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dwi00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 692 aa AA seqDB search
MGGRDAMQVEVKDIAKLFEQDGYLKPFEREIRRRHGVLQDWLGKIKDSEGGLDQFSQAYK
YYGLHFQPDNSVIAREWAPGARDVYLTGDFNNWHWEAHPFKKLDYGKWELHLPANADGSP
PIKHLSEIKVIIRNQSGQLLDRLSPWAKYVVQPPKEANQGVNYKQYVWQPPVAERYQPQH
KRPARPKSLRIYECHVGIASQEPRVGTYDEFADRIVPRIKKQGYNCIQVMAIMEHAYYAS
FGYQVTSFYAASSRCGNPEQLKRMIDVAHANGLYVLLDVVHSHASKNVQDGLNQFDGTNS
CFFHDGPKGEHSLWDSRLFNYMEYEVLRFLLSNLRWWHDEYNFDGYRFDGVTSMLYHSRG
IGEGFSGDYNEYFGLNVDTDSLNYLGLANHLLHTLDPEIITIAEDVSGMPTLCRPVSEGG
IGFDYRLGMAIPDKWIELLKEQSDDEWNMGNVVHTLTNRRWMENTVAYAESHDQALVGDK
TIAFWLMDKEMYTHMSTLSDSTLIIDRGIALHKIIRLITHALGGEAYLNFMGNEFGHPEW
LDFPRVGNNDSYHYARRQWNLVDDELLKYKYLNEFDRAMNQLEERFGWLHSGPAYVSWKH
EGDKIIAFERAGLVFVFNFHPQQSFTGYRVGTNWAGTYQAVLSSDDPLFGGHNRIDTQGK
HHSNPEGYAGRSNFIEVYAPSRTAVVYARISD
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgggtggtcgtgatgccatgcaagtggaagttaaggatatagccaaactttttgaacaa
gatggttacctgaagccttttgaacgtgagatacgcaggcgtcatggcgttcttcaggat
tggcttggcaagatcaaggacagcgagggaggcctggaccaattctcacaggcatacaaa
tattacggtttacattttcagccggataattcggttattgcccgcgaatgggctcccgga
gccagagatgtttatctaacgggagattttaataactggcactgggaggcacatcctttt
aagaaactggactatggcaagtgggaattgcatttgcccgctaatgcagatggaagtccc
ccaattaagcatctcagtgaaattaaggtgatcatacgcaatcaatccgggcaacttctg
gaccgtctatcgccatgggctaaatatgtggtccagccaccaaaggaggctaatcagggc
gtgaactacaaacaatatgtttggcaaccgccagttgcagaacgctatcaacctcagcac
aaacgtccggccaggcctaagtcgttgagaatctatgagtgccatgtgggaatagcgtcg
caggagcctcgagtgggcacctatgatgagtttgccgatcgtatagtgccgcgcatcaag
aaacagggctacaattgtatccaagttatggccattatggagcatgcctattacgccagc
tttggctatcaggtgaccagtttctatgctgcctccagccgttgtggcaatccggagcaa
cttaaacgcatgatcgatgtggcccacgcaaatggtctgtatgttttgttggatgtggtg
cactcgcatgcttccaagaatgtccaggacggtttgaaccagtttgatgggaccaatagc
tgcttctttcacgatggtccaaagggagaacattcgctgtgggacagcagactttttaac
tatatggagtatgaggtgttgcgcttcctgttgtccaatctgcgttggtggcacgacgag
tacaatttcgatggttatcgctttgatggtgtcacctctatgctgtaccattcacgtgga
attggcgagggattcagtggtgattataatgaatactttggccttaatgtggatacggat
tctcttaattacttgggtttggccaatcatttgctgcataccctcgatccggagattata
actatagccgaggacgtttccggcatgcccactctgtgccgccccgtctctgaaggcgga
atcggtttcgactatcgcctgggcatggcaatccctgacaaatggattgaattgttaaag
gaacaatccgacgatgagtggaatatgggtaacgtagtgcacactcttacaaatcgccgc
tggatggagaacacggtggcctatgccgaatcccatgatcaagctctggtgggagacaaa
accattgcattctggctaatggataaggaaatgtacacacatatgtcaacgctttcggac
tccacgctgattatagatcgcggtatagccctacataaaatcatacgtttgatcacgcat
gcgttgggtggagaggcgtacttgaacttcatgggtaacgaatttgggcatcccgagtgg
cttgatttcccacgtgtgggcaataacgactcttaccattatgcccgtcgtcaatggaat
ctcgtcgatgatgaactgctgaagtacaagtatcttaacgaattcgatcgtgccatgaat
caactagaggaacgtttcggttggctgcattccggacccgcctatgttagctggaagcat
gagggtgacaaaataattgctttcgagcgtgccggcttggttttcgttttcaatttccat
ccgcaacagagtttcaccggctaccgcgtcggcaccaattgggccggtacctaccaggcg
gttctctcatcggatgatccacttttcggtggccacaatcgcattgatactcaaggcaag
catcattcgaatcctgaaggttatgctggtcgttcgaattttattgaagtgtatgcgcca
tcccgtacagctgtcgtatatgccagaatcagtgattga

DBGET integrated database retrieval system