KEGG   Drosophila willistoni: Dwil_GK22252Help
Entry
Dwil_GK22252      CDS       T01067                                 

Definition
GK22252 gene product from transcript GK22252-RA
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
dwi  Drosophila willistoni
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:dwi04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 489 aa AA seqDB search
MWRLAAAVLIFGYIATASGAEQDVLDLGDDNFASTLKEHETTLVMFYAPWCGHCKRLKPE
YAKAAELVKDDDPPLKFAKVDCTEAGKETCSKYSVSGYPTLKIFRHDEVSQDYNGPREAN
GIVKYMRAQVGPASKNVHTVEELTKFLDTKDTTVFGYFEDLDSQLAKVFLKFADKNREKY
RFGHSSEEAVLKKQGETDKIVLIRAPHLNNKFESSSIKFEGSSESDLTTFVKENFHGLVG
HRTQDTARDFQNPLITAYYSVDYQKNPKGTNYWRNRVLKVAKEFAGQINFAISSKDDFQH
ELNEYGYDFVGEKPVILARDAKNLKYALKDEFSVENLQDFVEKLLANELEPYIKSEAVPE
SNDAPVKVAVAKNFDDVVINNGKDTLVEFYAPWCGHCKKLAPVFDELAEKLVDEDVAIVK
MDATANDVPPEFNVRGFPTLFWLPKDAKNKPISYNGGREVDDFVKYIAKEASSELKGFDR
SGKPKKTEL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgtttagcggctgctgtattaatttttggctacattgcgaccgcttctggagcc
gaacaagatgttctggacctaggagatgataactttgcatccactctgaaggaacatgag
actacattggttatgttctatgccccatggtgcggtcactgcaagcgcctgaagcctgaa
tatgccaaggccgctgagttagttaaggacgatgatcctccacttaaattcgccaaggtc
gattgtactgaggctggcaaggaaacttgcagcaagtattcggtcagcggttatcccaca
ttaaagatcttccgtcacgatgaggtctcccaggattacaatggaccacgtgaagccaat
ggcattgtcaagtatatgcgcgctcaggtgggcccagcctccaagaatgtacacactgtc
gaggagttgaccaaattcctggataccaaggacaccacagtttttggttactttgaggac
ctcgactctcagctggccaaggttttcctgaagtttgccgacaagaaccgcgagaagtat
cgctttggtcacagcagcgaggaggccgttctaaagaaacaaggcgaaaccgataagatt
gtgcttatccgtgccccccacttgaacaacaaattcgagtcatccagcattaagtttgaa
ggcagcagcgaatcagatctaactactttcgtcaaggagaacttccatggattggttggt
catcgcacacaggataccgctcgtgatttccagaatcctttgatcaccgcctactacagt
gtggactatcaaaagaatccaaagggtaccaactattggcgcaatcgtgtcctcaaggtt
gccaaggagtttgctggccagataaactttgccattagctccaaggatgatttccagcat
gaattgaatgagtatggctatgatttcgttggtgaaaagccagtgattttggcccgcgat
gccaagaatctcaagtatgcccttaaagacgaattctccgttgaaaatctccaagacttc
gtggagaaactattggccaatgaactcgaaccttacattaagagcgaagctgtacccgaa
tccaacgatgcgccagttaaagtggccgtcgctaagaactttgatgatgttgtcattaac
aatggcaaggatacacttgttgagttctatgctccatggtgcggacactgcaagaagctg
gctcccgtctttgatgaattggccgagaaattggttgatgaggatgttgccattgtcaaa
atggatgccaccgccaacgatgtgcccccagagttcaatgtgcgtggattccccacactt
ttctggctgcccaaggatgcgaagaataagccaattagctataacggaggacgcgaggtt
gatgactttgttaagtacattgccaaggaggctagctcagaactgaagggcttcgatcgc
agtggcaagcccaagaagaccgagctgtag

DBGET integrated database retrieval system