KEGG   Drosophila willistoni: Dwil_GK22343Help
Entry
Dwil_GK22343      CDS       T01067                                 

Definition
GK22343 gene product from transcript GK22343-RA
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dwi  Drosophila willistoni
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    Dwil_GK22343
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Dwil_GK22343
Protein phosphatases and associated proteins [BR:dwi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     Dwil_GK22343
Transcription machinery [BR:dwi03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     Dwil_GK22343
Spliceosome [BR:dwi03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dwil_GK22343
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 327 aa AA seqDB search
MSDIMNIDSIISRLLEVRGARPGKNVQLSESEIRSLCLKSREIFLSQPILLELEAPLKIC
GDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLR
GNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLSS
MEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVGKFLQKHEFD
LICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKR
RFVYPNFGSSGRPLTPPRGANNKNKKK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatatcatgaacatcgacagcattatctcccgtctgctggaggtgcgcggagca
cgtcctggtaaaaatgtgcaactgtcagagagcgaaatacgcagtttatgcttaaaatct
cgcgaaatatttctgtcacaacccattctattggaactggaggctccattaaagatatgt
ggtgacatccatggacaatattatgatctcttacgtctattcgagtatggcggtttccca
ccagaatccaattatctatttttaggagattatgtggatcgtggcaagcaatctctggaa
acaatttgcctacttctggcctataaaatcaaatattccgaaaatttctttttgctgcgc
ggcaatcatgagtgcgccagcattaatcgcatctacgggttctatgatgaatgcaaacgt
cgttacaccattaaattgtggaaaacgtttacggattgttttaattgtctgcccgttgca
gcaattgtcgacgagaagatcttttgctgtcacggtggcttaagcccggatctctcgtcg
atggagcaaattagacgcattatgcgtcccacagatgtacccgatcagggtctgttgtgt
gatctgttgtggtcagatcccgacaaggatacaatgggttggggcgaaaatgatcgtggt
gtaagctttacatttggagcagaggttgtgggtaaatttctacaaaagcacgaatttgat
cttatctgtcgtgcacatcaggttgttgaagatggttacgagttctttgccaaacgtcag
ttagttacgctattctcagcgcccaactattgcggagaatttgacaatgcgggtgccatg
atgtccgtggacgacacattaatgtgctcatttcagatattgaaacccgccgataagcga
cgatttgtatatcccaatttcggtagctcagggcgtccattaactccgccccgaggtgcc
aacaataaaaacaagaaaaaataa

DBGET integrated database retrieval system