KEGG   Drosophila willistoni: Dwil_GK22396Help
Entry
Dwil_GK22396      CDS       T01067                                 

Definition
(RefSeq) GK22396 gene product from transcript GK22396-RB
  KO
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
dwi  Drosophila willistoni
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dwil_GK22396
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dwil_GK22396
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dwil_GK22396
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Dwil_GK22396
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 558 aa AA seqDB search
MKLIVSLSQPCDLRLTNYGSVCVCNQTYCDYIEQTNLDDDLQILVISSSRNGLRFKSTKG
SFQDKYMSILDYKPSSDYETDAIIVEDNRAWLQLSRKRXYEQLISVHGXSIKPFCVPSAT
QKIKVSVKREQRYQNITNFGGAFTGSVSHILQKLPTELQDHVYRSYFHSDGIAYNSLRMT
IGGSDFDLEPWAYNELPRNDPLLTNFTKLDKRDLIKIHQMERLKTVGNLKTLKIMATAWS
APPWMKNNDRWTGFGQLKTEYYETWAKYYLRFLELMQSKNMPIWSISTGNEPLNGIIGFF
FVRFMSMGWTPWQQAIWLNDYLGPLIKNSTQSHVLIFGNDDQRYTYPSYFHKMRASRPNA
LDYLDGLAVHWYWDDVFGPQLIDKTHEEMPNKLLLNTESCVGDKPWQTHGPELGNWDRGE
QYMRSYMQDFQHHFNGWLDWNLVLDEQGGPNYVNNYVDAPIIVNTTSRSEIYKQPIYYAI
GHYSKFLPEQSVRIETETNLTNEFAQLKVVGFLRPDGTVVLIIYNGENLTVDVALKDSQS
GEFNLSIPARSWHTILYK
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttatagtatctctaagccaaccatgcgatctacgattaacgaattatggaagt
gtttgtgtttgcaatcaaacgtattgcgattatatagaacaaactaatctcgatgatgac
ttacaaattttagtgattagctctagcaggaatggtttgcgttttaagagcaccaaagga
agctttcaggacaagtacatgagcattttagactataaacccagcagtgactatgaaaca
gatgccattattgttgaggataacagagcctggttgcagctttcaaggaaacgttagtat
gaacaattaattagtgtacacggctaatctatcaaaccattttgtgtcccttcagctact
cagaagattaaagtttctgtgaaacgtgaacaacgttatcagaatatcaccaattttggt
ggagccttcacaggaagtgtgtctcatatactccaaaagttgcctacggaactgcaagat
catgtctatagatcttactttcattcggatggaatagcttataatagccttcgtatgacc
atagggggctccgatttcgatctagaaccatgggcatataatgaactaccgcgcaatgat
ccgcttttaactaattttaccaagctggataaacgtgatttaataaaaatccatcaaatg
gaacgtcttaaaactgttggcaatctaaaaacactgaaaattatggccactgcctggagt
gcaccaccctggatgaaaaacaatgatcgctggacaggttttggtcaattgaaaacggaa
tattatgaaacatgggccaaatactatctcagatttcttgaacttatgcagtctaaaaat
atgccgatttggtccatatccactggtaatgagcctttaaacggcattattggcttcttt
tttgtacgcttcatgagcatgggctggaccccatggcagcaggcaatttggctgaacgat
tatctggggccactcataaagaactcaacgcaaagtcatgtgctaatctttggcaatgat
gaccaacgctatacgtatccctcctattttcataagatgcgtgcctctcgtccaaatgct
ttggactacttggatggtctggctgttcattggtattgggatgatgtatttggcccccaa
ttaattgataagacccatgaggagatgccaaataaattattattaaatacagaatcttgt
gttggcgataaaccatggcaaacccatggcccagagttgggcaattgggatcgcggtgag
caatatatgagatcatatatgcaagatttccagcatcattttaatggctggctggattgg
aatctagtattagatgagcaaggtggacccaattatgtaaacaactatgtggatgctcca
ataattgtgaatacaacgagtcgttcggagatttataagcaaccaatctattatgccata
ggacattattccaagtttttgcccgaacaatctgtgcgcatcgaaacggagaccaattta
accaatgaatttgctcaactcaaagtcgtcggttttctacgtccggatggcactgtggtg
ctgatcatatacaatggtgaaaatctgacagtggatgtcgccctcaaagatagtcaaagt
ggagaatttaatctaagcattccagcacgctcttggcacacaatattgtataaatga

DBGET integrated database retrieval system