KEGG   Drosophila willistoni: Dwil_GK22547Help
Entry
Dwil_GK22547      CDS       T01067                                 

Definition
(RefSeq) GK22547 gene product from transcript GK22547-RE
  KO
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dwil_GK22547
Protein kinases [BR:dwi01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   Dwil_GK22547
Spliceosome [BR:dwi03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dwil_GK22547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 570 aa AA seqDB search
MFSTITQPNLTWQTIVQLVGGIWKRFSIPRPPPLLALPAPPIKPTTAPEGKTTQKDEMPR
TRRRHNSRDRSSAGTRDKRRRLDTGDHSPHLIPEAPSPPRITKTHHTRSAAKRRRHELDA
NTSSHISKEPTFDDSISSRRRKERSKRSHRKSPASSRRQHKYRYRDETSHSSSRRRHRDR
PKDERDSGRNNRQSQSKTAKPVIQDDADGHLIYHTGDILHHRYKIMATLGEGTFGRVVKV
KDMERDYCMALKIIKNVEKYREAAKLEINALEKIAQKDPHGDHLCVKMIDWFDYHGHMCI
VFEMLGLSVFDFLRENNYEPYPLDQVRHMAYQLCYSVKFLHDSRLTHTDLKPENILFVDS
DYTAHYNHKINREVRRVKNTDVRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQP
CDVWSIGCILFELYLGITLFQTHDNREHLAMMERILGQIPYRMARKTKTKYFYHGKLDWD
EKSSAGRYVRDHCKPLFLCQLSDSEDHCELFSLIKKMLEYEPSSRITLGEALRHPFFDRL
PPHHRVGEVSNKQPLSSGSSSRERSHSLSR
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgttctcaaccataacccaacctaatcttacttggcaaacaatcgtccaactagttggc
ggtatttggaaacgtttttctatccctcgaccgccgccattgctagctcttcccgcgcca
cccattaaaccaacaacagcacctgagggtaaaacaacgcaaaaagacgagatgccacga
acacggagacgccataattctagggatcgctcctcggcgggcacacgagacaaacgtaga
cgacttgatactggcgatcattcgccacacttaataccggaagcaccgtcgccgccgcgc
attaccaagacacaccacaccagatcggcggccaaacgaaggcgacatgaacttgatgca
aatacctcttcccatatatccaaggagccaacctttgatgacagtatctcttcccgccga
cgtaaggagcgctcaaagcgttcgcatcgtaaatcgcctgcctcgagcaggcgacaacac
aaataccgttacagggacgagacctcacattcgagctctcgtcgccggcatcgtgatcgg
cccaaggatgagcgtgacagtggacgcaataatcgccaatcgcaatctaagacagcaaaa
cccgtcattcaagatgatgctgatggtcacttaatttaccacaccggagacattctccat
cacagatataaaatcatggccactttgggcgaaggtacattcggacgagtggtcaaggtg
aaagacatggagcgtgactactgcatggccctgaaaatcataaaaaatgtggaaaaatat
cgtgaggcagcgaaactcgagatcaatgccttggagaaaatagcccaaaaagatccacat
ggtgatcacttgtgcgtaaaaatgattgactggtttgactatcatggacacatgtgcata
gtgtttgaaatgcttggcctaagtgttttcgattttttgcgcgagaacaactatgagccg
tatccgctggatcaagtgcgacatatggcgtatcaattatgctactctgtgaagtttcta
catgacagtcgtttaacgcacacggatctcaagccggagaatatattatttgttgattcg
gactatacggctcattataatcataagattaatcgcgaagtacgccgtgtcaaaaacaca
gatgtccgtctaattgactttggctcggctacttttgatcacgaacatcacagtacaatt
gtctcgacgcgacattatcgcgcgcctgaggtcatactggagctgggatggtcacaaccc
tgtgatgtatggtccattggctgcattcttttcgaactgtatctgggcatcacactgttt
cagacccacgacaatcgcgaacatctggccatgatggaacgaattttgggacaaatacca
tatcgcatggcacgcaaaaccaaaaccaagtacttctatcacggtaagttagattgggat
gagaagtcgagtgcgggtcgttatgtgcgtgatcattgcaaaccattgttcctgtgccaa
ctgagcgacagtgaggatcactgtgagctcttcagtttgattaaaaagatgctggaatac
gagccctcatcacgaattacgttaggtgaggctttgcgtcatccattctttgatagacta
ccaccacaccatcgagttggcgaagtaagcaacaagcagccactctcctccggcagcagt
agccgggagcgctctcacagtctgtccagatga

DBGET integrated database retrieval system