KEGG   Drosophila willistoni: Dwil_GK22596Help
Entry
Dwil_GK22596      CDS       T01067                                 

Definition
GK22596 gene product from transcript GK22596-RA
Orthology
K04437  
filamin
Organism
dwi  Drosophila willistoni
Brite
Exosome [BR:dwi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dwil_GK22596
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 264 aa AA seqDB search
MFKVSQEIRLNINAAGSASSSSIISGIPDPEKDGTFGRYQRTPEADAYPTEPPHVYIAPE
LTDPSKVQLMHFPNGAMRVDSTLNFNIKRNGVKGNFDVRLEGPSGQPVAVRQQQLDPERF
QIESNLNVGAGLYKVHIKCNSVSLPRSPFIIVVIGEGTNPNQLKPDSDFQSDASKIQSRG
LGLSHINLVERNEFTVDASQAGHDMLFVGILGPKGYPCDEVFVKHLGRNVHRVIYRVSES
GAYILIAKWGDEHIPGSPFRLSAE
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagtgtcgcaggagattcgtttgaatataaatgcggcagggagtgcctcctct
tcgtccatcatctcgggcattccagatccggagaaagatggaacttttgggcggtatcaa
cgcacgcccgaggcggatgcatatcccactgagccgccacacgtctacatagcacccgaa
ttgaccgatccgagtaaagtgcaattgatgcactttcccaatggcgccatgcgtgtcgac
tctacgttgaattttaatatcaaacggaatggagtgaagggtaatttcgatgttcgtctc
gagggacccagtggtcagccagtagcagtgcgtcagcaacaattggacccggagcgtttc
caaattgagagcaatcttaatgttggagcaggtctttacaaggttcatattaaatgcaat
tccgtttccttgcccagatcaccatttattattgtggtcattggtgaaggtacaaatccc
aaccagttgaaaccagattcggactttcaatcggatgccagtaaaattcagagtcgtggc
ctgggtctaagtcacattaatcttgtggagcgtaatgaattcactgtggatgccagtcaa
gctggacatgatatgctctttgtgggcatccttggaccaaaaggttatccctgtgatgag
gtatttgtcaaacacttgggacgaaatgtccatcgagtgatctatcgtgttagtgaatcg
ggagcttacattttgatagcaaaatggggagatgagcatataccaggatctccctttaga
ctaagtgctgaatag

DBGET integrated database retrieval system